Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PAG8

Protein Details
Accession A0A4Q9PAG8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
17-39APLAIKTQTKKEKKQKRGLESPEHydrophilic
NLS Segment(s)
PositionSequence
29-30KK
Subcellular Location(s) cyto 14, cysk 12
Family & Domain DBs
Amino Acid Sequences MGCIPSKNKVLEADSSAPLAIKTQTKKEKKQKRGLESPEIGEDAAPWVHGPGRVLSEKDGMVVITDSRPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.26
4 0.22
5 0.19
6 0.17
7 0.13
8 0.15
9 0.17
10 0.25
11 0.35
12 0.43
13 0.53
14 0.63
15 0.71
16 0.75
17 0.83
18 0.83
19 0.81
20 0.83
21 0.79
22 0.76
23 0.67
24 0.58
25 0.49
26 0.41
27 0.32
28 0.22
29 0.16
30 0.09
31 0.07
32 0.06
33 0.05
34 0.05
35 0.06
36 0.07
37 0.09
38 0.09
39 0.13
40 0.16
41 0.17
42 0.19
43 0.2
44 0.19
45 0.19
46 0.18
47 0.13
48 0.12
49 0.12
50 0.11