Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V2K6G6

Protein Details
Accession A0A4V2K6G6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
55-78SPPAQARPPLRRPRTTYRPRTCRTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 19, mito 3, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIPETLIKSKPRPVQSSLILHLALFAPITSLFSALCYFSLPQPHAQAKPAPLCRSPPAQARPPLRRPRTTYRPRTCRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.58
4 0.53
5 0.47
6 0.39
7 0.34
8 0.29
9 0.23
10 0.16
11 0.1
12 0.07
13 0.05
14 0.05
15 0.06
16 0.05
17 0.05
18 0.05
19 0.06
20 0.07
21 0.06
22 0.06
23 0.06
24 0.06
25 0.08
26 0.11
27 0.11
28 0.13
29 0.17
30 0.2
31 0.2
32 0.22
33 0.23
34 0.24
35 0.31
36 0.34
37 0.33
38 0.32
39 0.35
40 0.36
41 0.39
42 0.39
43 0.4
44 0.41
45 0.45
46 0.52
47 0.57
48 0.63
49 0.68
50 0.75
51 0.74
52 0.76
53 0.76
54 0.78
55 0.8
56 0.82
57 0.83
58 0.84