Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9Q4K1

Protein Details
Accession A0A4Q9Q4K1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
30-55LCVPTRFGWKRPKRDTKRGSRSFDRDHydrophilic
NLS Segment(s)
PositionSequence
39-47KRPKRDTKR
Subcellular Location(s) mito 13, extr 6, nucl 3, plas 2, cyto_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSLSRASRASRRVKLWLHCHALEGCFLFLLCVPTRFGWKRPKRDTKRGSRSFDRDGLHHSIPQDRPKGFQLASLSGVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.66
3 0.66
4 0.63
5 0.56
6 0.55
7 0.48
8 0.41
9 0.34
10 0.27
11 0.19
12 0.12
13 0.11
14 0.09
15 0.08
16 0.1
17 0.09
18 0.09
19 0.1
20 0.11
21 0.18
22 0.19
23 0.25
24 0.32
25 0.4
26 0.49
27 0.58
28 0.69
29 0.71
30 0.81
31 0.84
32 0.85
33 0.88
34 0.87
35 0.84
36 0.81
37 0.78
38 0.73
39 0.69
40 0.59
41 0.5
42 0.46
43 0.45
44 0.38
45 0.34
46 0.3
47 0.31
48 0.34
49 0.4
50 0.42
51 0.37
52 0.39
53 0.4
54 0.45
55 0.37
56 0.37
57 0.35
58 0.31