Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9PT79

Protein Details
Accession A0A4Q9PT79    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-27SYSTGTDHLRRRRRRLIATRASVHydrophilic
NLS Segment(s)
PositionSequence
14-21RRRRRRLI
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 4
Family & Domain DBs
Amino Acid Sequences MRDDSYSTGTDHLRRRRRRLIATRASVLRPRLERRHSLLLFVLSPDQSLLAWPQQGLEPRTSTMLHDKDRCNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.65
3 0.72
4 0.77
5 0.81
6 0.83
7 0.84
8 0.83
9 0.8
10 0.76
11 0.69
12 0.63
13 0.56
14 0.48
15 0.42
16 0.37
17 0.38
18 0.4
19 0.42
20 0.43
21 0.45
22 0.52
23 0.47
24 0.44
25 0.38
26 0.32
27 0.27
28 0.23
29 0.19
30 0.09
31 0.09
32 0.08
33 0.07
34 0.05
35 0.06
36 0.07
37 0.08
38 0.08
39 0.08
40 0.09
41 0.12
42 0.17
43 0.19
44 0.2
45 0.2
46 0.21
47 0.23
48 0.23
49 0.24
50 0.28
51 0.32
52 0.37
53 0.42