Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PGF8

Protein Details
Accession A0A4Q9PGF8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
36-55SWFATACKRQRRKERADSLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 5, pero 3
Family & Domain DBs
Amino Acid Sequences FDNVSQTSDVPARAILAKRVKSMPGLAHHTAQDVCSWFATACKRQRRKERADSLVRARNLPPPRGVGEGEPGAGEERYRCRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.23
3 0.29
4 0.31
5 0.33
6 0.35
7 0.35
8 0.32
9 0.34
10 0.31
11 0.29
12 0.34
13 0.32
14 0.32
15 0.3
16 0.3
17 0.27
18 0.23
19 0.18
20 0.13
21 0.12
22 0.1
23 0.1
24 0.08
25 0.11
26 0.14
27 0.2
28 0.26
29 0.36
30 0.44
31 0.52
32 0.63
33 0.69
34 0.75
35 0.79
36 0.8
37 0.79
38 0.79
39 0.77
40 0.75
41 0.72
42 0.64
43 0.56
44 0.48
45 0.47
46 0.44
47 0.41
48 0.35
49 0.31
50 0.33
51 0.34
52 0.34
53 0.27
54 0.27
55 0.25
56 0.23
57 0.19
58 0.17
59 0.16
60 0.14
61 0.14
62 0.12