Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9NQD3

Protein Details
Accession A0A4Q9NQD3    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGPPPSPKEPRRSGRRPAPSSSKSHydrophilic
NLS Segment(s)
PositionSequence
7-27PKEPRRSGRRPAPSSSKSPAG
89-96SKRKGKDK
316-321KKKRKR
368-384PAPRAPNGRNKRAGGRK
Subcellular Location(s) nucl 17, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019786  Zinc_finger_PHD-type_CS  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR019787  Znf_PHD-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00628  PHD  
PROSITE View protein in PROSITE  
PS01359  ZF_PHD_1  
Amino Acid Sequences MGPPPSPKEPRRSGRRPAPSSSKSPAGSPPSEANPAATKPKDAPGRPSSNSSHSNGSVRNKRAKNEDLDEPLEELHKNGVNTNGGSLRSKRKGKDKEKIALVVEIPNNDNDGGLEAVADDGAEENGEDEEEGGVTRCICQKYGVSRRVDRPETYCQSSLSGEEENEQGEFMVQCEICKAWQHGQCMHYAAADLVPNHYFCEECRPELWVEVVKDWAVKHARQSSSHSYPPTTPLVANVPRNSRSHSPAVHKTTKRRNTMNSRDAAYDEETLQALIDLPKTEYDLPPRTPISAVSANGGLNGHAEPEHEIEMQVNHKKKRKRSDDDAASVKRTRSASVTSDRPPPSVLARDATPLSVSKGPAGPSSGAPAPRAPNGRNKRAGGRKGQGQDVASVDGEEVASAAPTRKASSRAKANNSSEHTTRRAQANASGAAAGNSAASRAYHHSHAYAVSQQPLFTSWNLPDYLAHLEPMLPTDVPRPLEVRGSVLDGNGRESQDRTAERGVKVKWPSKRMSVGDMNKRVRSLVEWVGREQAAAMERTRRKEALEKALQAHQRAAAGDMDVDASIADGAPAPENGLSTANSAPPPLAEVMTGGGGEDTTMRMMEELMEELIRFQERFGPGAKAKERDRRAGTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.88
3 0.84
4 0.83
5 0.83
6 0.78
7 0.77
8 0.72
9 0.69
10 0.59
11 0.56
12 0.55
13 0.52
14 0.48
15 0.45
16 0.44
17 0.41
18 0.44
19 0.41
20 0.36
21 0.33
22 0.35
23 0.39
24 0.35
25 0.34
26 0.32
27 0.4
28 0.46
29 0.45
30 0.5
31 0.51
32 0.59
33 0.58
34 0.62
35 0.58
36 0.57
37 0.59
38 0.53
39 0.49
40 0.44
41 0.46
42 0.47
43 0.52
44 0.54
45 0.56
46 0.63
47 0.62
48 0.64
49 0.68
50 0.68
51 0.67
52 0.63
53 0.63
54 0.59
55 0.57
56 0.52
57 0.44
58 0.38
59 0.31
60 0.26
61 0.19
62 0.17
63 0.17
64 0.17
65 0.18
66 0.21
67 0.22
68 0.22
69 0.25
70 0.24
71 0.23
72 0.26
73 0.3
74 0.35
75 0.41
76 0.48
77 0.51
78 0.59
79 0.68
80 0.75
81 0.8
82 0.8
83 0.8
84 0.79
85 0.77
86 0.68
87 0.6
88 0.51
89 0.47
90 0.4
91 0.33
92 0.28
93 0.23
94 0.22
95 0.19
96 0.17
97 0.11
98 0.11
99 0.09
100 0.08
101 0.07
102 0.06
103 0.06
104 0.06
105 0.05
106 0.03
107 0.03
108 0.03
109 0.04
110 0.03
111 0.04
112 0.04
113 0.05
114 0.04
115 0.04
116 0.04
117 0.05
118 0.05
119 0.05
120 0.06
121 0.06
122 0.08
123 0.13
124 0.14
125 0.15
126 0.17
127 0.21
128 0.31
129 0.41
130 0.46
131 0.48
132 0.54
133 0.61
134 0.68
135 0.67
136 0.6
137 0.55
138 0.58
139 0.57
140 0.56
141 0.49
142 0.41
143 0.38
144 0.36
145 0.32
146 0.24
147 0.2
148 0.14
149 0.15
150 0.14
151 0.13
152 0.12
153 0.11
154 0.08
155 0.07
156 0.07
157 0.06
158 0.09
159 0.09
160 0.09
161 0.1
162 0.1
163 0.1
164 0.14
165 0.17
166 0.21
167 0.25
168 0.29
169 0.33
170 0.34
171 0.35
172 0.34
173 0.31
174 0.23
175 0.19
176 0.15
177 0.12
178 0.12
179 0.1
180 0.1
181 0.11
182 0.11
183 0.11
184 0.11
185 0.1
186 0.08
187 0.19
188 0.18
189 0.19
190 0.19
191 0.21
192 0.22
193 0.22
194 0.24
195 0.18
196 0.17
197 0.16
198 0.17
199 0.14
200 0.15
201 0.14
202 0.19
203 0.18
204 0.18
205 0.24
206 0.31
207 0.33
208 0.34
209 0.41
210 0.43
211 0.45
212 0.49
213 0.44
214 0.38
215 0.37
216 0.38
217 0.34
218 0.26
219 0.21
220 0.18
221 0.23
222 0.26
223 0.29
224 0.29
225 0.31
226 0.33
227 0.34
228 0.37
229 0.34
230 0.34
231 0.35
232 0.36
233 0.39
234 0.44
235 0.51
236 0.55
237 0.56
238 0.6
239 0.66
240 0.69
241 0.69
242 0.66
243 0.67
244 0.69
245 0.74
246 0.73
247 0.65
248 0.59
249 0.53
250 0.48
251 0.41
252 0.32
253 0.23
254 0.16
255 0.14
256 0.12
257 0.1
258 0.1
259 0.07
260 0.06
261 0.05
262 0.06
263 0.05
264 0.06
265 0.06
266 0.08
267 0.09
268 0.1
269 0.16
270 0.2
271 0.21
272 0.24
273 0.24
274 0.23
275 0.22
276 0.21
277 0.2
278 0.19
279 0.18
280 0.15
281 0.16
282 0.15
283 0.15
284 0.14
285 0.09
286 0.07
287 0.06
288 0.06
289 0.05
290 0.05
291 0.06
292 0.07
293 0.08
294 0.07
295 0.08
296 0.08
297 0.09
298 0.13
299 0.17
300 0.21
301 0.25
302 0.31
303 0.37
304 0.45
305 0.54
306 0.61
307 0.64
308 0.67
309 0.72
310 0.73
311 0.73
312 0.73
313 0.64
314 0.56
315 0.5
316 0.41
317 0.35
318 0.28
319 0.24
320 0.19
321 0.2
322 0.21
323 0.24
324 0.29
325 0.27
326 0.35
327 0.35
328 0.33
329 0.3
330 0.27
331 0.25
332 0.24
333 0.22
334 0.16
335 0.16
336 0.17
337 0.16
338 0.15
339 0.13
340 0.1
341 0.12
342 0.12
343 0.12
344 0.11
345 0.13
346 0.14
347 0.14
348 0.15
349 0.13
350 0.12
351 0.14
352 0.15
353 0.14
354 0.14
355 0.16
356 0.16
357 0.19
358 0.23
359 0.21
360 0.3
361 0.37
362 0.43
363 0.47
364 0.47
365 0.52
366 0.57
367 0.61
368 0.59
369 0.56
370 0.55
371 0.52
372 0.53
373 0.46
374 0.38
375 0.34
376 0.27
377 0.24
378 0.16
379 0.14
380 0.11
381 0.08
382 0.08
383 0.05
384 0.04
385 0.03
386 0.03
387 0.03
388 0.04
389 0.06
390 0.07
391 0.08
392 0.1
393 0.17
394 0.22
395 0.29
396 0.38
397 0.45
398 0.52
399 0.59
400 0.6
401 0.61
402 0.62
403 0.59
404 0.52
405 0.48
406 0.45
407 0.39
408 0.39
409 0.35
410 0.32
411 0.29
412 0.3
413 0.3
414 0.27
415 0.24
416 0.21
417 0.17
418 0.15
419 0.14
420 0.1
421 0.06
422 0.05
423 0.05
424 0.04
425 0.05
426 0.06
427 0.1
428 0.13
429 0.15
430 0.16
431 0.17
432 0.18
433 0.18
434 0.18
435 0.2
436 0.19
437 0.2
438 0.2
439 0.19
440 0.18
441 0.19
442 0.19
443 0.15
444 0.16
445 0.13
446 0.15
447 0.16
448 0.16
449 0.14
450 0.15
451 0.19
452 0.16
453 0.15
454 0.13
455 0.13
456 0.12
457 0.14
458 0.13
459 0.08
460 0.09
461 0.11
462 0.15
463 0.16
464 0.17
465 0.17
466 0.17
467 0.21
468 0.2
469 0.2
470 0.17
471 0.19
472 0.18
473 0.17
474 0.19
475 0.15
476 0.19
477 0.19
478 0.19
479 0.17
480 0.18
481 0.19
482 0.23
483 0.24
484 0.24
485 0.29
486 0.33
487 0.34
488 0.39
489 0.39
490 0.4
491 0.46
492 0.49
493 0.5
494 0.51
495 0.54
496 0.54
497 0.61
498 0.56
499 0.56
500 0.59
501 0.6
502 0.64
503 0.69
504 0.67
505 0.61
506 0.59
507 0.52
508 0.43
509 0.36
510 0.32
511 0.31
512 0.33
513 0.33
514 0.34
515 0.37
516 0.36
517 0.33
518 0.28
519 0.22
520 0.17
521 0.17
522 0.18
523 0.23
524 0.28
525 0.33
526 0.38
527 0.36
528 0.37
529 0.44
530 0.5
531 0.51
532 0.55
533 0.54
534 0.53
535 0.59
536 0.59
537 0.53
538 0.46
539 0.38
540 0.32
541 0.27
542 0.25
543 0.19
544 0.15
545 0.14
546 0.12
547 0.11
548 0.09
549 0.08
550 0.06
551 0.05
552 0.05
553 0.04
554 0.04
555 0.04
556 0.05
557 0.07
558 0.07
559 0.08
560 0.08
561 0.09
562 0.1
563 0.11
564 0.11
565 0.12
566 0.14
567 0.16
568 0.16
569 0.16
570 0.15
571 0.13
572 0.15
573 0.14
574 0.13
575 0.1
576 0.1
577 0.11
578 0.11
579 0.11
580 0.08
581 0.07
582 0.06
583 0.06
584 0.06
585 0.06
586 0.06
587 0.06
588 0.06
589 0.06
590 0.07
591 0.08
592 0.08
593 0.09
594 0.09
595 0.1
596 0.1
597 0.1
598 0.13
599 0.14
600 0.13
601 0.12
602 0.18
603 0.2
604 0.22
605 0.24
606 0.29
607 0.31
608 0.4
609 0.46
610 0.46
611 0.53
612 0.61
613 0.65
614 0.67