Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9Q9G0

Protein Details
Accession A0A4Q9Q9G0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
134-159ADTSAPPSKHRSRRRVKGPRPRPASMHydrophilic
NLS Segment(s)
PositionSequence
140-157PSKHRSRRRVKGPRPRPA
Subcellular Location(s) mito 14, nucl 11.5, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MVNSIRRRGSLPAASARAIRKTIGLPRSKSFMWPSHAAPDERQPPSLPSVSRDFTLVSNPSSQDEIEYTPAARPRVRIPRKSSQQPAAIDTDALSAVDECPIQDREPELKPSNDMQNQTQITLAGPVDSSSSPADTSAPPSKHRSRRRVKGPRPRPASMSAAVDGDGRRRYARPARPDNSIPHEIFETRFENPFSPRSWSATLKREKGSASDTSSQASCTSRRLSVFGMLSTFRRSLVKKSDGDESPRDPSPLSLDSSASSTGASVSSASSRSRWSFCMRNGVPRTDPYGPPYFAQPPIPSADADRGRRAAGRIAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.48
3 0.46
4 0.43
5 0.38
6 0.33
7 0.28
8 0.3
9 0.37
10 0.41
11 0.46
12 0.46
13 0.48
14 0.53
15 0.5
16 0.5
17 0.48
18 0.46
19 0.44
20 0.43
21 0.42
22 0.45
23 0.49
24 0.45
25 0.41
26 0.44
27 0.46
28 0.44
29 0.44
30 0.37
31 0.35
32 0.38
33 0.41
34 0.33
35 0.28
36 0.32
37 0.32
38 0.31
39 0.29
40 0.25
41 0.21
42 0.26
43 0.24
44 0.19
45 0.21
46 0.21
47 0.22
48 0.22
49 0.21
50 0.17
51 0.16
52 0.16
53 0.16
54 0.15
55 0.15
56 0.16
57 0.2
58 0.22
59 0.21
60 0.22
61 0.28
62 0.38
63 0.47
64 0.52
65 0.57
66 0.65
67 0.73
68 0.8
69 0.78
70 0.74
71 0.72
72 0.65
73 0.61
74 0.53
75 0.44
76 0.35
77 0.28
78 0.21
79 0.14
80 0.12
81 0.09
82 0.06
83 0.06
84 0.06
85 0.06
86 0.05
87 0.08
88 0.1
89 0.1
90 0.1
91 0.13
92 0.17
93 0.2
94 0.26
95 0.26
96 0.26
97 0.28
98 0.3
99 0.35
100 0.35
101 0.34
102 0.3
103 0.35
104 0.34
105 0.32
106 0.29
107 0.21
108 0.17
109 0.16
110 0.14
111 0.07
112 0.06
113 0.06
114 0.08
115 0.07
116 0.09
117 0.07
118 0.08
119 0.08
120 0.08
121 0.09
122 0.08
123 0.13
124 0.18
125 0.2
126 0.22
127 0.29
128 0.38
129 0.46
130 0.56
131 0.61
132 0.65
133 0.72
134 0.81
135 0.85
136 0.87
137 0.88
138 0.89
139 0.88
140 0.85
141 0.78
142 0.69
143 0.62
144 0.56
145 0.46
146 0.38
147 0.28
148 0.21
149 0.2
150 0.17
151 0.14
152 0.13
153 0.12
154 0.11
155 0.11
156 0.12
157 0.18
158 0.26
159 0.33
160 0.39
161 0.48
162 0.5
163 0.54
164 0.57
165 0.55
166 0.53
167 0.51
168 0.42
169 0.33
170 0.31
171 0.27
172 0.24
173 0.23
174 0.18
175 0.15
176 0.16
177 0.16
178 0.17
179 0.19
180 0.2
181 0.18
182 0.22
183 0.22
184 0.24
185 0.27
186 0.31
187 0.34
188 0.41
189 0.47
190 0.46
191 0.46
192 0.44
193 0.41
194 0.38
195 0.36
196 0.31
197 0.29
198 0.29
199 0.28
200 0.27
201 0.27
202 0.25
203 0.22
204 0.21
205 0.16
206 0.16
207 0.18
208 0.19
209 0.2
210 0.22
211 0.22
212 0.25
213 0.25
214 0.22
215 0.21
216 0.19
217 0.2
218 0.21
219 0.19
220 0.15
221 0.18
222 0.19
223 0.24
224 0.32
225 0.38
226 0.38
227 0.4
228 0.46
229 0.45
230 0.49
231 0.48
232 0.43
233 0.4
234 0.38
235 0.37
236 0.29
237 0.27
238 0.26
239 0.24
240 0.23
241 0.2
242 0.19
243 0.19
244 0.21
245 0.2
246 0.15
247 0.12
248 0.09
249 0.09
250 0.08
251 0.08
252 0.06
253 0.07
254 0.08
255 0.11
256 0.12
257 0.13
258 0.18
259 0.22
260 0.24
261 0.27
262 0.32
263 0.38
264 0.41
265 0.5
266 0.47
267 0.54
268 0.56
269 0.58
270 0.55
271 0.5
272 0.53
273 0.47
274 0.47
275 0.43
276 0.45
277 0.41
278 0.38
279 0.41
280 0.38
281 0.36
282 0.39
283 0.34
284 0.3
285 0.33
286 0.33
287 0.28
288 0.27
289 0.33
290 0.36
291 0.39
292 0.41
293 0.39
294 0.39
295 0.42
296 0.41