Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PM42

Protein Details
Accession A0A4Q9PM42    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
95-120GEEKPRLQFTRRRRKPLPHRLQLHPIBasic
NLS Segment(s)
PositionSequence
105-110RRRRKP
Subcellular Location(s) cyto_nucl 12, nucl 11.5, cyto 9.5, cysk 3
Family & Domain DBs
Amino Acid Sequences MCYAGNIMAQTCFCENQTSSVVCRGTGWLHIESAKDEHGFIEHYFDHTGRVRHRQEVRSPLLSDYVITALTVSREIIRHSGGRSGQEGTLKDPVGEEKPRLQFTRRRRKPLPHRLQLHPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.2
4 0.24
5 0.23
6 0.23
7 0.27
8 0.27
9 0.23
10 0.23
11 0.2
12 0.18
13 0.2
14 0.21
15 0.16
16 0.17
17 0.18
18 0.18
19 0.18
20 0.18
21 0.16
22 0.13
23 0.12
24 0.11
25 0.11
26 0.12
27 0.1
28 0.12
29 0.11
30 0.12
31 0.13
32 0.13
33 0.15
34 0.16
35 0.2
36 0.2
37 0.28
38 0.29
39 0.35
40 0.42
41 0.43
42 0.46
43 0.51
44 0.52
45 0.46
46 0.45
47 0.38
48 0.33
49 0.28
50 0.22
51 0.14
52 0.11
53 0.07
54 0.06
55 0.06
56 0.04
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.08
63 0.09
64 0.11
65 0.13
66 0.13
67 0.18
68 0.18
69 0.2
70 0.2
71 0.21
72 0.2
73 0.22
74 0.22
75 0.21
76 0.24
77 0.22
78 0.2
79 0.19
80 0.2
81 0.22
82 0.24
83 0.24
84 0.27
85 0.33
86 0.38
87 0.4
88 0.43
89 0.46
90 0.54
91 0.63
92 0.65
93 0.69
94 0.72
95 0.81
96 0.86
97 0.89
98 0.9
99 0.88
100 0.86