Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9QBJ6

Protein Details
Accession A0A4Q9QBJ6    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
82-109NTKGQEYQPSQRKRKRKHGFLSRKVTVNHydrophilic
NLS Segment(s)
PositionSequence
93-122RKRKRKHGFLSRKVTVNGRKMLARRRAKGR
Subcellular Location(s) mito 14, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRIPPSLARLLSRPPTLPTAVPRAATSVSFASSLTPFKPILPSASPTSSLLRSLPTLLTRLNLIPATLSPIFSPLLQVRHNTKGQEYQPSQRKRKRKHGFLSRKVTVNGRKMLARRRAKGRLFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.34
3 0.35
4 0.35
5 0.35
6 0.32
7 0.34
8 0.33
9 0.32
10 0.29
11 0.28
12 0.26
13 0.24
14 0.22
15 0.15
16 0.14
17 0.13
18 0.13
19 0.12
20 0.12
21 0.14
22 0.12
23 0.13
24 0.12
25 0.13
26 0.15
27 0.14
28 0.17
29 0.17
30 0.2
31 0.21
32 0.22
33 0.23
34 0.22
35 0.24
36 0.2
37 0.19
38 0.16
39 0.14
40 0.13
41 0.12
42 0.12
43 0.1
44 0.11
45 0.1
46 0.1
47 0.1
48 0.1
49 0.1
50 0.09
51 0.08
52 0.07
53 0.07
54 0.11
55 0.1
56 0.1
57 0.09
58 0.1
59 0.11
60 0.1
61 0.13
62 0.1
63 0.14
64 0.14
65 0.18
66 0.21
67 0.26
68 0.28
69 0.27
70 0.27
71 0.31
72 0.32
73 0.39
74 0.38
75 0.42
76 0.49
77 0.58
78 0.66
79 0.67
80 0.75
81 0.75
82 0.83
83 0.84
84 0.85
85 0.87
86 0.88
87 0.91
88 0.91
89 0.91
90 0.85
91 0.79
92 0.71
93 0.68
94 0.65
95 0.61
96 0.56
97 0.49
98 0.5
99 0.51
100 0.58
101 0.6
102 0.61
103 0.62
104 0.66
105 0.73
106 0.73
107 0.77