Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PCD3

Protein Details
Accession A0A4Q9PCD3    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MYHCAQNSKRQRKPQKVPDASKHRDKEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 6.5, pero 3, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MYHCAQNSKRQRKPQKVPDASKHRDKEAMDGFPCQGWLSVTVTDGSDSLFITLGHRLDHIPYVPIDLPDSVVALVRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.9
4 0.9
5 0.9
6 0.89
7 0.84
8 0.83
9 0.75
10 0.66
11 0.61
12 0.53
13 0.5
14 0.44
15 0.43
16 0.35
17 0.33
18 0.31
19 0.26
20 0.25
21 0.18
22 0.13
23 0.07
24 0.08
25 0.08
26 0.08
27 0.08
28 0.08
29 0.08
30 0.08
31 0.08
32 0.07
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.06
39 0.08
40 0.09
41 0.09
42 0.09
43 0.1
44 0.11
45 0.13
46 0.13
47 0.12
48 0.12
49 0.16
50 0.16
51 0.17
52 0.17
53 0.15
54 0.16
55 0.14
56 0.15
57 0.11