Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9NPJ2

Protein Details
Accession A0A4Q9NPJ2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MCAPDGRRERRSRIPRADLTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR011047  Quinoprotein_ADH-like_supfam  
Amino Acid Sequences MCAPDGRRERRSRIPRADLTPGFTQAPTPTDVDVAITSFSDLSLNLRELLIFDVTPDGYLQLERERAAGAAPIRLKAVLQMEHRVNVLPKCGRDPLVCIQHIFLETRRENPFEAELYTPGPSLADEDPVIALVVSADGRWFPSRASNSTVTAWDTKNHLVSWNWAADEPSVDGLAISLGGGYILSVVRDPSAEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.78
4 0.79
5 0.7
6 0.65
7 0.57
8 0.5
9 0.42
10 0.34
11 0.3
12 0.22
13 0.23
14 0.19
15 0.18
16 0.15
17 0.14
18 0.14
19 0.14
20 0.12
21 0.11
22 0.09
23 0.08
24 0.08
25 0.07
26 0.07
27 0.06
28 0.06
29 0.07
30 0.09
31 0.1
32 0.1
33 0.1
34 0.1
35 0.1
36 0.12
37 0.11
38 0.08
39 0.07
40 0.08
41 0.08
42 0.08
43 0.08
44 0.06
45 0.06
46 0.06
47 0.07
48 0.08
49 0.1
50 0.1
51 0.1
52 0.1
53 0.1
54 0.1
55 0.12
56 0.1
57 0.12
58 0.13
59 0.13
60 0.13
61 0.13
62 0.12
63 0.12
64 0.14
65 0.15
66 0.16
67 0.2
68 0.21
69 0.22
70 0.22
71 0.2
72 0.2
73 0.16
74 0.19
75 0.16
76 0.16
77 0.18
78 0.19
79 0.2
80 0.19
81 0.22
82 0.23
83 0.27
84 0.27
85 0.24
86 0.23
87 0.22
88 0.22
89 0.19
90 0.15
91 0.16
92 0.16
93 0.21
94 0.23
95 0.23
96 0.23
97 0.23
98 0.23
99 0.17
100 0.18
101 0.14
102 0.13
103 0.13
104 0.13
105 0.11
106 0.09
107 0.08
108 0.07
109 0.09
110 0.08
111 0.08
112 0.08
113 0.08
114 0.08
115 0.08
116 0.08
117 0.05
118 0.05
119 0.03
120 0.04
121 0.03
122 0.03
123 0.03
124 0.04
125 0.06
126 0.08
127 0.08
128 0.08
129 0.16
130 0.2
131 0.23
132 0.28
133 0.28
134 0.29
135 0.31
136 0.32
137 0.27
138 0.26
139 0.25
140 0.22
141 0.23
142 0.23
143 0.24
144 0.23
145 0.24
146 0.21
147 0.25
148 0.27
149 0.25
150 0.23
151 0.22
152 0.22
153 0.19
154 0.2
155 0.17
156 0.13
157 0.11
158 0.1
159 0.09
160 0.08
161 0.08
162 0.06
163 0.04
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.04
170 0.04
171 0.05
172 0.05
173 0.06
174 0.07