Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PDU7

Protein Details
Accession A0A4Q9PDU7    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
37-62SAVAYISRRSRKRKHRPNLQSCLRVEHydrophilic
NLS Segment(s)
PositionSequence
44-52RRSRKRKHR
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MVMPLRTRSPALQSRSRVSQAPDDPRETQPDTTHIHSAVAYISRRSRKRKHRPNLQSCLRVEPLANPSSLPCIPIRASSLRSLRFLYSYTQTDSALPPTRWPCDRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.56
4 0.5
5 0.46
6 0.48
7 0.47
8 0.51
9 0.5
10 0.49
11 0.5
12 0.49
13 0.51
14 0.45
15 0.39
16 0.31
17 0.32
18 0.31
19 0.3
20 0.3
21 0.24
22 0.22
23 0.2
24 0.18
25 0.15
26 0.14
27 0.12
28 0.13
29 0.18
30 0.25
31 0.32
32 0.39
33 0.48
34 0.56
35 0.67
36 0.75
37 0.8
38 0.84
39 0.89
40 0.9
41 0.91
42 0.87
43 0.82
44 0.72
45 0.66
46 0.56
47 0.45
48 0.35
49 0.28
50 0.26
51 0.2
52 0.19
53 0.15
54 0.14
55 0.18
56 0.18
57 0.16
58 0.12
59 0.14
60 0.14
61 0.16
62 0.19
63 0.18
64 0.21
65 0.26
66 0.32
67 0.32
68 0.33
69 0.34
70 0.31
71 0.29
72 0.28
73 0.26
74 0.25
75 0.25
76 0.27
77 0.26
78 0.25
79 0.26
80 0.26
81 0.29
82 0.31
83 0.28
84 0.32
85 0.36
86 0.41