Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9PCJ3

Protein Details
Accession A0A4Q9PCJ3    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
46-71QEPAQSGGRKRKAPRRKNRTLSSIAEHydrophilic
NLS Segment(s)
PositionSequence
53-64GRKRKAPRRKNR
95-113PKKRKVDPSAGQKRLRPAS
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences AAPQVPPPDTEEAETQVVPPIDDPADEDETQQDGSQKDDSEEDAPQEPAQSGGRKRKAPRRKNRTLSSIAEEDSQDEDDPEDGPAGELDSDAPPPKKRKVDPSAGQKRLRPASMSPTRPTTRSGDRRAQGSSRGRASSLRATDLGAKRTSDNPTRRTGGPSTSHRSKSVISDSDREAARQQEGRLSSPLSDPPPTQSPGLRARILDGVGSRASEVGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.22
4 0.21
5 0.18
6 0.16
7 0.15
8 0.13
9 0.13
10 0.15
11 0.15
12 0.2
13 0.2
14 0.2
15 0.19
16 0.2
17 0.2
18 0.19
19 0.17
20 0.13
21 0.16
22 0.18
23 0.17
24 0.17
25 0.17
26 0.19
27 0.17
28 0.18
29 0.18
30 0.17
31 0.18
32 0.17
33 0.16
34 0.14
35 0.14
36 0.16
37 0.19
38 0.24
39 0.34
40 0.4
41 0.46
42 0.54
43 0.63
44 0.71
45 0.76
46 0.8
47 0.81
48 0.85
49 0.88
50 0.88
51 0.85
52 0.8
53 0.73
54 0.67
55 0.59
56 0.49
57 0.4
58 0.33
59 0.26
60 0.21
61 0.18
62 0.12
63 0.1
64 0.09
65 0.08
66 0.09
67 0.07
68 0.06
69 0.05
70 0.05
71 0.05
72 0.05
73 0.04
74 0.04
75 0.05
76 0.05
77 0.06
78 0.09
79 0.11
80 0.15
81 0.19
82 0.26
83 0.31
84 0.34
85 0.43
86 0.47
87 0.55
88 0.59
89 0.65
90 0.7
91 0.71
92 0.7
93 0.62
94 0.61
95 0.54
96 0.47
97 0.38
98 0.29
99 0.31
100 0.36
101 0.38
102 0.34
103 0.38
104 0.38
105 0.37
106 0.39
107 0.34
108 0.36
109 0.4
110 0.45
111 0.46
112 0.47
113 0.48
114 0.48
115 0.44
116 0.43
117 0.41
118 0.4
119 0.35
120 0.34
121 0.32
122 0.31
123 0.34
124 0.32
125 0.27
126 0.24
127 0.21
128 0.21
129 0.28
130 0.3
131 0.3
132 0.24
133 0.24
134 0.23
135 0.27
136 0.32
137 0.33
138 0.37
139 0.37
140 0.42
141 0.45
142 0.44
143 0.45
144 0.42
145 0.39
146 0.4
147 0.43
148 0.46
149 0.5
150 0.51
151 0.48
152 0.48
153 0.43
154 0.42
155 0.42
156 0.4
157 0.36
158 0.37
159 0.38
160 0.41
161 0.39
162 0.35
163 0.3
164 0.26
165 0.28
166 0.27
167 0.26
168 0.26
169 0.28
170 0.3
171 0.3
172 0.29
173 0.25
174 0.24
175 0.28
176 0.26
177 0.27
178 0.24
179 0.28
180 0.31
181 0.32
182 0.32
183 0.3
184 0.33
185 0.38
186 0.43
187 0.4
188 0.35
189 0.36
190 0.37
191 0.35
192 0.3
193 0.23
194 0.21
195 0.19
196 0.19
197 0.17
198 0.14