Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9PIN8

Protein Details
Accession A0A4Q9PIN8    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-36TSYRSHFSRKIRRSRSAPRAWTHydrophilic
NLS Segment(s)
PositionSequence
24-33KIRRSRSAPR
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MQWSLVWTRSCHRITSYRSHFSRKIRRSRSAPRAWTPSHLSRPDPSRRGSGALRLRAASLTAKAASRCWRGCVSWYCFLDSQGVGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.51
3 0.55
4 0.56
5 0.58
6 0.63
7 0.64
8 0.66
9 0.71
10 0.7
11 0.72
12 0.71
13 0.76
14 0.78
15 0.82
16 0.82
17 0.81
18 0.78
19 0.73
20 0.72
21 0.65
22 0.6
23 0.56
24 0.52
25 0.5
26 0.45
27 0.41
28 0.37
29 0.43
30 0.46
31 0.43
32 0.38
33 0.35
34 0.34
35 0.36
36 0.33
37 0.35
38 0.34
39 0.35
40 0.34
41 0.31
42 0.3
43 0.27
44 0.27
45 0.2
46 0.14
47 0.12
48 0.12
49 0.14
50 0.14
51 0.17
52 0.23
53 0.29
54 0.29
55 0.31
56 0.33
57 0.32
58 0.39
59 0.44
60 0.44
61 0.46
62 0.46
63 0.46
64 0.44
65 0.44
66 0.4