Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9PSP5

Protein Details
Accession A0A4Q9PSP5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
68-90APLTRTATWHRCRQRHRCGVGVFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MRSRRSKFLLRPLTMWNIKAVGWATYEQRLRANMLGGCAVLLVPVEALRDRTAARPSMWHGELLRSEAPLTRTATWHRCRQRHRCGVGVFVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.5
3 0.41
4 0.32
5 0.28
6 0.28
7 0.23
8 0.15
9 0.14
10 0.15
11 0.15
12 0.2
13 0.21
14 0.2
15 0.21
16 0.22
17 0.22
18 0.21
19 0.22
20 0.17
21 0.16
22 0.15
23 0.13
24 0.11
25 0.09
26 0.08
27 0.05
28 0.04
29 0.03
30 0.02
31 0.03
32 0.03
33 0.03
34 0.05
35 0.05
36 0.06
37 0.07
38 0.1
39 0.12
40 0.14
41 0.14
42 0.16
43 0.18
44 0.23
45 0.23
46 0.22
47 0.2
48 0.22
49 0.22
50 0.23
51 0.21
52 0.15
53 0.15
54 0.16
55 0.17
56 0.18
57 0.2
58 0.18
59 0.21
60 0.27
61 0.36
62 0.4
63 0.48
64 0.55
65 0.6
66 0.69
67 0.77
68 0.81
69 0.82
70 0.82
71 0.8
72 0.73