Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V2K845

Protein Details
Accession A0A4V2K845    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
34-62VSKTPQGTQHRRRPSRPRWKSFRCRRLTLHydrophilic
NLS Segment(s)
PositionSequence
45-51RRPSRPR
87-92RRRGGW
Subcellular Location(s) cysk 18, mito 4, cyto 3, cyto_nucl 2.833, mito_nucl 2.833
Family & Domain DBs
Amino Acid Sequences MEVVVLAHDADQIAVELGFDWVVPSHYTLRVDVVSKTPQGTQHRRRPSRPRWKSFRCRRLTLEGGCRVTFWYAGFGGQRGWTGGRLRRRGGWSALRVKWRIGRRGSCMGLMCLMGPRIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.05
9 0.06
10 0.07
11 0.09
12 0.11
13 0.14
14 0.15
15 0.15
16 0.17
17 0.17
18 0.18
19 0.17
20 0.19
21 0.19
22 0.19
23 0.2
24 0.19
25 0.25
26 0.32
27 0.41
28 0.47
29 0.54
30 0.64
31 0.69
32 0.76
33 0.79
34 0.82
35 0.83
36 0.84
37 0.83
38 0.83
39 0.87
40 0.9
41 0.9
42 0.89
43 0.84
44 0.78
45 0.73
46 0.69
47 0.65
48 0.58
49 0.54
50 0.49
51 0.45
52 0.4
53 0.36
54 0.29
55 0.24
56 0.21
57 0.13
58 0.1
59 0.08
60 0.09
61 0.09
62 0.09
63 0.09
64 0.09
65 0.09
66 0.08
67 0.08
68 0.11
69 0.15
70 0.21
71 0.29
72 0.33
73 0.35
74 0.4
75 0.44
76 0.45
77 0.47
78 0.49
79 0.48
80 0.53
81 0.56
82 0.57
83 0.54
84 0.54
85 0.55
86 0.54
87 0.54
88 0.54
89 0.56
90 0.55
91 0.62
92 0.61
93 0.57
94 0.52
95 0.45
96 0.37
97 0.31
98 0.25
99 0.19