Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PJ70

Protein Details
Accession A0A4Q9PJ70    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
29-64SERARDCKRGKLREKKERGHRRERERTRDRTRTAYRBasic
NLS Segment(s)
PositionSequence
28-69DSERARDCKRGKLREKKERGHRRERERTRDRTRTAYRPSRRA
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MITRHHGSRSSRWLPSKNHSKDSGRGGDSERARDCKRGKLREKKERGHRRERERTRDRTRTAYRPSRRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.67
3 0.7
4 0.66
5 0.65
6 0.64
7 0.61
8 0.59
9 0.61
10 0.57
11 0.47
12 0.42
13 0.4
14 0.4
15 0.38
16 0.37
17 0.32
18 0.31
19 0.31
20 0.36
21 0.35
22 0.37
23 0.45
24 0.5
25 0.58
26 0.64
27 0.73
28 0.77
29 0.85
30 0.84
31 0.87
32 0.88
33 0.87
34 0.87
35 0.86
36 0.86
37 0.88
38 0.89
39 0.88
40 0.87
41 0.88
42 0.88
43 0.88
44 0.82
45 0.81
46 0.8
47 0.78
48 0.79
49 0.79