Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9NQN9

Protein Details
Accession A0A4Q9NQN9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
331-356GWFASEKKFLRRRRARWVKKPVLEWLHydrophilic
NLS Segment(s)
PositionSequence
337-350KKFLRRRRARWVKK
Subcellular Location(s) mito 16, cyto 7.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR000073  AB_hydrolase_1  
IPR012020  ABHD4  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF00561  Abhydrolase_1  
Amino Acid Sequences MTMRDFVCSKCPSLLKEFHPSRLLFNGHLQTAYSAYGDFSEVDKIMYDRKLIRLLDGGTLSLDFTPPEDERHLSDDTPIIVTFHGLTGGSNEAYVRAILAPACAPVEEGGLGYRAVVVNYRGCAGTPVTSEKLYHCGNTDDARQALMYISHRYPKAKLIGLGFSLGANILVRYLAQEGEQSRLIAGCALGCPWDLHSVSYKLSNGAWVDRMYSRMLAGNMATLIKANKDVLANNPKLAKALPYLFSLPSPTLWDFDKYYAYEEKELETLGAFRDQGDFYRWASSHTALSDVRVPLLAINADDDPIIRDLPVDAGENPLVSLVVTRGGGHLGWFASEKKFLRRRRARWVKKPVLEWLGAVGEDLSGDPSKCRPVYENDGFLYEAGRPGLGCRQVEGGGKFHGEMLRVLPNSTAGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.46
3 0.54
4 0.56
5 0.55
6 0.58
7 0.55
8 0.5
9 0.5
10 0.47
11 0.39
12 0.43
13 0.41
14 0.36
15 0.35
16 0.32
17 0.26
18 0.24
19 0.22
20 0.15
21 0.1
22 0.1
23 0.1
24 0.1
25 0.1
26 0.1
27 0.12
28 0.12
29 0.12
30 0.12
31 0.13
32 0.17
33 0.17
34 0.2
35 0.21
36 0.25
37 0.31
38 0.3
39 0.32
40 0.31
41 0.31
42 0.31
43 0.28
44 0.24
45 0.18
46 0.18
47 0.17
48 0.12
49 0.11
50 0.07
51 0.07
52 0.11
53 0.12
54 0.15
55 0.17
56 0.19
57 0.21
58 0.25
59 0.26
60 0.22
61 0.23
62 0.21
63 0.19
64 0.19
65 0.17
66 0.13
67 0.11
68 0.12
69 0.1
70 0.08
71 0.08
72 0.07
73 0.07
74 0.08
75 0.1
76 0.09
77 0.08
78 0.08
79 0.08
80 0.09
81 0.08
82 0.07
83 0.06
84 0.07
85 0.07
86 0.08
87 0.07
88 0.07
89 0.08
90 0.07
91 0.07
92 0.07
93 0.07
94 0.06
95 0.06
96 0.06
97 0.07
98 0.07
99 0.06
100 0.07
101 0.06
102 0.06
103 0.08
104 0.09
105 0.1
106 0.11
107 0.12
108 0.11
109 0.11
110 0.12
111 0.12
112 0.12
113 0.12
114 0.16
115 0.17
116 0.18
117 0.18
118 0.18
119 0.22
120 0.21
121 0.2
122 0.17
123 0.17
124 0.19
125 0.2
126 0.22
127 0.2
128 0.19
129 0.18
130 0.16
131 0.15
132 0.13
133 0.13
134 0.12
135 0.13
136 0.15
137 0.19
138 0.21
139 0.22
140 0.23
141 0.26
142 0.29
143 0.27
144 0.28
145 0.26
146 0.27
147 0.25
148 0.24
149 0.19
150 0.14
151 0.12
152 0.09
153 0.07
154 0.05
155 0.04
156 0.03
157 0.03
158 0.03
159 0.04
160 0.05
161 0.05
162 0.05
163 0.08
164 0.08
165 0.11
166 0.12
167 0.11
168 0.1
169 0.1
170 0.1
171 0.08
172 0.07
173 0.04
174 0.04
175 0.04
176 0.04
177 0.05
178 0.05
179 0.05
180 0.09
181 0.09
182 0.09
183 0.12
184 0.13
185 0.13
186 0.15
187 0.14
188 0.12
189 0.12
190 0.13
191 0.11
192 0.1
193 0.12
194 0.1
195 0.11
196 0.11
197 0.12
198 0.11
199 0.11
200 0.1
201 0.1
202 0.1
203 0.09
204 0.08
205 0.07
206 0.07
207 0.07
208 0.06
209 0.05
210 0.05
211 0.05
212 0.06
213 0.06
214 0.07
215 0.08
216 0.09
217 0.16
218 0.24
219 0.24
220 0.25
221 0.26
222 0.24
223 0.24
224 0.24
225 0.18
226 0.13
227 0.15
228 0.15
229 0.16
230 0.17
231 0.17
232 0.17
233 0.17
234 0.14
235 0.12
236 0.14
237 0.13
238 0.12
239 0.13
240 0.15
241 0.15
242 0.16
243 0.18
244 0.14
245 0.17
246 0.19
247 0.2
248 0.2
249 0.19
250 0.19
251 0.17
252 0.17
253 0.14
254 0.1
255 0.09
256 0.08
257 0.08
258 0.07
259 0.07
260 0.09
261 0.09
262 0.1
263 0.13
264 0.14
265 0.14
266 0.19
267 0.19
268 0.19
269 0.21
270 0.22
271 0.2
272 0.18
273 0.21
274 0.16
275 0.18
276 0.2
277 0.18
278 0.16
279 0.15
280 0.14
281 0.11
282 0.12
283 0.11
284 0.06
285 0.08
286 0.08
287 0.08
288 0.08
289 0.08
290 0.08
291 0.09
292 0.09
293 0.07
294 0.07
295 0.07
296 0.08
297 0.09
298 0.09
299 0.09
300 0.11
301 0.11
302 0.11
303 0.11
304 0.1
305 0.08
306 0.07
307 0.07
308 0.05
309 0.06
310 0.06
311 0.07
312 0.07
313 0.08
314 0.08
315 0.08
316 0.1
317 0.08
318 0.08
319 0.1
320 0.12
321 0.13
322 0.19
323 0.21
324 0.29
325 0.38
326 0.45
327 0.55
328 0.64
329 0.69
330 0.75
331 0.84
332 0.85
333 0.88
334 0.91
335 0.9
336 0.86
337 0.83
338 0.79
339 0.73
340 0.63
341 0.52
342 0.44
343 0.34
344 0.27
345 0.23
346 0.15
347 0.09
348 0.08
349 0.08
350 0.08
351 0.08
352 0.09
353 0.1
354 0.13
355 0.2
356 0.21
357 0.23
358 0.25
359 0.31
360 0.41
361 0.46
362 0.49
363 0.43
364 0.44
365 0.42
366 0.38
367 0.31
368 0.22
369 0.17
370 0.12
371 0.11
372 0.09
373 0.12
374 0.19
375 0.23
376 0.23
377 0.22
378 0.25
379 0.28
380 0.34
381 0.34
382 0.3
383 0.27
384 0.28
385 0.26
386 0.27
387 0.25
388 0.21
389 0.2
390 0.2
391 0.26
392 0.25
393 0.26
394 0.23