Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PDS9

Protein Details
Accession A0A4Q9PDS9    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
22-56TSTSVWRHRKVPRKETNKSRRRFRRRRVGTQGEEEBasic
NLS Segment(s)
PositionSequence
28-48RHRKVPRKETNKSRRRFRRRR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences WRDAEQSDETVLDEDAWRAEPTSTSVWRHRKVPRKETNKSRRRFRRRRVGTQGEEEQRATTGDQLQPKTSRSQDGHRATSCEDASWAPASHEPADHLRPVPRCAGRTRFCPWVPHIRQLSPDLYYHLGSHTRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.11
4 0.11
5 0.1
6 0.11
7 0.11
8 0.14
9 0.19
10 0.22
11 0.25
12 0.34
13 0.42
14 0.44
15 0.51
16 0.57
17 0.62
18 0.68
19 0.74
20 0.76
21 0.77
22 0.83
23 0.87
24 0.89
25 0.88
26 0.86
27 0.86
28 0.87
29 0.89
30 0.9
31 0.89
32 0.89
33 0.89
34 0.91
35 0.91
36 0.89
37 0.82
38 0.78
39 0.75
40 0.67
41 0.59
42 0.48
43 0.38
44 0.28
45 0.24
46 0.18
47 0.12
48 0.12
49 0.13
50 0.17
51 0.18
52 0.2
53 0.21
54 0.22
55 0.24
56 0.22
57 0.25
58 0.23
59 0.28
60 0.36
61 0.4
62 0.43
63 0.4
64 0.41
65 0.36
66 0.38
67 0.32
68 0.22
69 0.18
70 0.13
71 0.14
72 0.14
73 0.13
74 0.1
75 0.12
76 0.14
77 0.14
78 0.14
79 0.15
80 0.17
81 0.19
82 0.2
83 0.2
84 0.23
85 0.25
86 0.27
87 0.32
88 0.32
89 0.33
90 0.38
91 0.45
92 0.44
93 0.47
94 0.5
95 0.51
96 0.49
97 0.51
98 0.5
99 0.52
100 0.52
101 0.56
102 0.57
103 0.5
104 0.52
105 0.51
106 0.48
107 0.39
108 0.36
109 0.31
110 0.28
111 0.27
112 0.23
113 0.23