Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V2K967

Protein Details
Accession A0A4V2K967    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
87-108FDLSLHKYRRFKKQFREVIAEGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MKMYHYLRQWGLDVSKGRAFILRTIRQTIRFSYSSICIKAGHKLATQHRARVIVQKSEVTWLGTHAFHAVFSRKPHAYAGLLKSLQFDLSLHKYRRFKKQFREVIAEGLSPLTLLCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.29
4 0.28
5 0.27
6 0.27
7 0.27
8 0.33
9 0.35
10 0.36
11 0.42
12 0.44
13 0.46
14 0.47
15 0.44
16 0.41
17 0.35
18 0.33
19 0.29
20 0.31
21 0.3
22 0.28
23 0.26
24 0.22
25 0.22
26 0.26
27 0.26
28 0.24
29 0.22
30 0.27
31 0.32
32 0.39
33 0.4
34 0.38
35 0.36
36 0.36
37 0.35
38 0.37
39 0.34
40 0.28
41 0.28
42 0.26
43 0.24
44 0.24
45 0.23
46 0.16
47 0.13
48 0.11
49 0.11
50 0.1
51 0.1
52 0.09
53 0.09
54 0.08
55 0.1
56 0.11
57 0.11
58 0.14
59 0.19
60 0.18
61 0.19
62 0.2
63 0.21
64 0.22
65 0.25
66 0.26
67 0.27
68 0.27
69 0.26
70 0.27
71 0.25
72 0.22
73 0.16
74 0.14
75 0.13
76 0.2
77 0.28
78 0.3
79 0.37
80 0.45
81 0.51
82 0.62
83 0.66
84 0.68
85 0.71
86 0.79
87 0.8
88 0.8
89 0.82
90 0.72
91 0.68
92 0.61
93 0.5
94 0.39
95 0.31
96 0.23
97 0.14