Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PDL9

Protein Details
Accession A0A4Q9PDL9    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
85-112KGKGKDDRNSENKRKPKKDRPKALAAEEBasic
NLS Segment(s)
PositionSequence
71-106GRDAKDAKDAKGKGKGKGKDDRNSENKRKPKKDRPK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MVSSINHTKDLADADEIVARIRQHASRIYDSEVAMTARAKKRRGPPPCFTCGKPGYARDCPNHDTKNAKDGRDAKDAKDAKGKGKGKGKDDRNSENKRKPKKDRPKALAAEEDDSDSDSDEYAYALIEHINSDLGEDSEEIALA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.16
4 0.15
5 0.15
6 0.13
7 0.13
8 0.16
9 0.17
10 0.18
11 0.24
12 0.29
13 0.32
14 0.34
15 0.36
16 0.35
17 0.34
18 0.31
19 0.26
20 0.21
21 0.17
22 0.16
23 0.19
24 0.24
25 0.3
26 0.31
27 0.37
28 0.46
29 0.55
30 0.64
31 0.64
32 0.67
33 0.69
34 0.73
35 0.7
36 0.62
37 0.6
38 0.52
39 0.48
40 0.42
41 0.4
42 0.39
43 0.42
44 0.45
45 0.4
46 0.43
47 0.41
48 0.44
49 0.41
50 0.37
51 0.36
52 0.32
53 0.38
54 0.37
55 0.34
56 0.33
57 0.37
58 0.4
59 0.44
60 0.44
61 0.35
62 0.41
63 0.42
64 0.38
65 0.4
66 0.36
67 0.31
68 0.4
69 0.42
70 0.39
71 0.46
72 0.49
73 0.49
74 0.56
75 0.6
76 0.58
77 0.61
78 0.64
79 0.65
80 0.7
81 0.73
82 0.73
83 0.75
84 0.78
85 0.81
86 0.83
87 0.85
88 0.87
89 0.88
90 0.9
91 0.88
92 0.88
93 0.83
94 0.77
95 0.73
96 0.64
97 0.56
98 0.45
99 0.39
100 0.29
101 0.24
102 0.19
103 0.13
104 0.11
105 0.08
106 0.08
107 0.07
108 0.07
109 0.06
110 0.06
111 0.05
112 0.05
113 0.05
114 0.05
115 0.06
116 0.06
117 0.07
118 0.07
119 0.08
120 0.08
121 0.08
122 0.09
123 0.09
124 0.1