Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PCC2

Protein Details
Accession A0A4Q9PCC2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MAIRHRRTHKSQPSWFDKVFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 19, mito 4, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029164  PIG-Y  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF15159  PIG-Y  
Amino Acid Sequences MAIRHRRTHKSQPSWFDKVFPPNRSKEARPGPPSPAAGYALIAASVAFLLVGSYAVFFSALVPVTGVWLLDVMARDTHYKYLVIILISSGTGFVIANWVGWQYYRNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.73
3 0.66
4 0.6
5 0.6
6 0.6
7 0.56
8 0.54
9 0.51
10 0.57
11 0.58
12 0.56
13 0.55
14 0.57
15 0.6
16 0.6
17 0.58
18 0.56
19 0.55
20 0.53
21 0.44
22 0.37
23 0.29
24 0.23
25 0.2
26 0.15
27 0.11
28 0.09
29 0.08
30 0.05
31 0.04
32 0.03
33 0.03
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.05
52 0.05
53 0.05
54 0.04
55 0.03
56 0.04
57 0.05
58 0.05
59 0.06
60 0.06
61 0.08
62 0.1
63 0.11
64 0.12
65 0.12
66 0.12
67 0.11
68 0.13
69 0.14
70 0.13
71 0.11
72 0.1
73 0.09
74 0.09
75 0.09
76 0.06
77 0.05
78 0.05
79 0.04
80 0.04
81 0.07
82 0.07
83 0.07
84 0.08
85 0.08
86 0.08
87 0.09