Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9PH75

Protein Details
Accession A0A4Q9PH75    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
58-78PTPKEQKKRTGLKEKAKAHKSBasic
NLS Segment(s)
PositionSequence
30-80DKKKTSSAGSAPRSAVQSAPKPKTAVSAPTPKEQKKRTGLKEKAKAHKSKR
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
Amino Acid Sequences MREKSACGALQFSHPYIIMGRSAKFYKRTDKKKTSSAGSAPRSAVQSAPKPKTAVSAPTPKEQKKRTGLKEKAKAHKSKREGDIPVLGGADYVELMLGGRRKAAAEAAKLPKDPDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.2
4 0.2
5 0.18
6 0.17
7 0.17
8 0.2
9 0.23
10 0.27
11 0.31
12 0.35
13 0.41
14 0.49
15 0.58
16 0.64
17 0.71
18 0.73
19 0.75
20 0.76
21 0.7
22 0.66
23 0.63
24 0.61
25 0.55
26 0.52
27 0.45
28 0.41
29 0.37
30 0.31
31 0.26
32 0.21
33 0.25
34 0.31
35 0.33
36 0.33
37 0.32
38 0.32
39 0.33
40 0.3
41 0.27
42 0.24
43 0.3
44 0.3
45 0.35
46 0.41
47 0.42
48 0.48
49 0.47
50 0.51
51 0.51
52 0.58
53 0.61
54 0.67
55 0.71
56 0.74
57 0.8
58 0.8
59 0.81
60 0.8
61 0.79
62 0.76
63 0.77
64 0.73
65 0.72
66 0.69
67 0.67
68 0.62
69 0.56
70 0.53
71 0.44
72 0.38
73 0.3
74 0.24
75 0.16
76 0.13
77 0.1
78 0.05
79 0.04
80 0.03
81 0.03
82 0.03
83 0.06
84 0.08
85 0.08
86 0.09
87 0.1
88 0.11
89 0.12
90 0.18
91 0.2
92 0.23
93 0.32
94 0.39
95 0.42
96 0.43