Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PNJ1

Protein Details
Accession A0A4Q9PNJ1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKVRIVGWFRRLRRRRRTGFESPPSWHydrophilic
NLS Segment(s)
PositionSequence
12-16LRRRR
Subcellular Location(s) mito 14.5, mito_nucl 11.666, cyto_mito 10.499, nucl 6.5, cyto_nucl 6.499, cyto 5
Family & Domain DBs
Amino Acid Sequences MKVRIVGWFRRLRRRRRTGFESPPSWEPSMNLWFSKVHHFHHPFFESRLARGRSICAISSISHGRPSTRYSITVVQPLAGNAGVNNNTVTNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.84
4 0.86
5 0.85
6 0.87
7 0.85
8 0.77
9 0.71
10 0.65
11 0.6
12 0.52
13 0.42
14 0.32
15 0.28
16 0.29
17 0.26
18 0.22
19 0.19
20 0.19
21 0.2
22 0.27
23 0.25
24 0.23
25 0.31
26 0.35
27 0.36
28 0.41
29 0.42
30 0.35
31 0.34
32 0.38
33 0.29
34 0.27
35 0.32
36 0.28
37 0.27
38 0.26
39 0.26
40 0.21
41 0.22
42 0.21
43 0.15
44 0.14
45 0.14
46 0.17
47 0.19
48 0.17
49 0.2
50 0.2
51 0.2
52 0.21
53 0.24
54 0.26
55 0.25
56 0.26
57 0.25
58 0.31
59 0.32
60 0.35
61 0.32
62 0.27
63 0.25
64 0.23
65 0.21
66 0.15
67 0.13
68 0.08
69 0.13
70 0.13
71 0.13
72 0.14