Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9P3D4

Protein Details
Accession A0A4Q9P3D4    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
114-137GSARDTRTGRRPQQRQHVRQRGATHydrophilic
NLS Segment(s)
PositionSequence
38-53RGRKMEIRRAVGRMRR
Subcellular Location(s) nucl 13, mito 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MYKAATVILRNNASQQFATDNTTRTETTVKNGRGDEGRGRKMEIRRAVGRMRRRDDGTDDTEDPTGRRWTSDGDSELDVREQTRTGRAPLTPRSARNRIHGSVRSSSTPERRAGSARDTRTGRRPQQRQHVRQRGATYQDVWDDVSESERRGMQGRGQGGRMRDAKMMCGRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.26
3 0.23
4 0.22
5 0.27
6 0.24
7 0.23
8 0.23
9 0.26
10 0.25
11 0.23
12 0.27
13 0.23
14 0.27
15 0.35
16 0.35
17 0.36
18 0.36
19 0.38
20 0.36
21 0.39
22 0.41
23 0.4
24 0.43
25 0.39
26 0.42
27 0.44
28 0.47
29 0.52
30 0.49
31 0.47
32 0.45
33 0.49
34 0.54
35 0.55
36 0.59
37 0.6
38 0.58
39 0.57
40 0.56
41 0.54
42 0.52
43 0.51
44 0.46
45 0.42
46 0.38
47 0.34
48 0.32
49 0.29
50 0.24
51 0.21
52 0.19
53 0.14
54 0.14
55 0.13
56 0.15
57 0.17
58 0.21
59 0.19
60 0.18
61 0.19
62 0.19
63 0.18
64 0.15
65 0.13
66 0.1
67 0.09
68 0.07
69 0.07
70 0.1
71 0.11
72 0.12
73 0.14
74 0.15
75 0.19
76 0.23
77 0.3
78 0.3
79 0.33
80 0.4
81 0.44
82 0.45
83 0.47
84 0.49
85 0.43
86 0.46
87 0.46
88 0.42
89 0.4
90 0.4
91 0.35
92 0.32
93 0.35
94 0.34
95 0.34
96 0.32
97 0.3
98 0.3
99 0.31
100 0.31
101 0.34
102 0.36
103 0.34
104 0.39
105 0.4
106 0.42
107 0.48
108 0.55
109 0.56
110 0.59
111 0.65
112 0.66
113 0.75
114 0.82
115 0.83
116 0.85
117 0.87
118 0.81
119 0.78
120 0.74
121 0.69
122 0.64
123 0.56
124 0.47
125 0.39
126 0.35
127 0.31
128 0.26
129 0.2
130 0.16
131 0.13
132 0.15
133 0.14
134 0.14
135 0.15
136 0.16
137 0.17
138 0.18
139 0.2
140 0.21
141 0.27
142 0.32
143 0.34
144 0.36
145 0.38
146 0.37
147 0.43
148 0.42
149 0.38
150 0.36
151 0.34
152 0.38