Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PX26

Protein Details
Accession A0A4Q9PX26    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
26-68KPETAPKKAPAKPRSKKAPAAEGEDKPKPTKGKKRTASEKDAEBasic
NLS Segment(s)
PositionSequence
15-66PRRSARIKDQPKPETAPKKAPAKPRSKKAPAAEGEDKPKPTKGKKRTASEKD
75-155NGEEPPAKKVKPASKAAAKPASKAAGAKPASKASRAGSAKPASRAASAKPASKASAKPPSSAAKKPASRAGSKKPASKAGA
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MPRKAAPAADTNAEPRRSARIKDQPKPETAPKKAPAKPRSKKAPAAEGEDKPKPTKGKKRTASEKDAEDGAPEANGEEPPAKKVKPASKAAAKPASKAAGAKPASKASRAGSAKPASRAASAKPASKASAKPPSSAAKKPASRAGSKKPASKAGAAEKENAAAAAPETIAEEPEAEDAANAEPATEQAAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.3
3 0.36
4 0.37
5 0.39
6 0.44
7 0.48
8 0.57
9 0.64
10 0.73
11 0.69
12 0.7
13 0.73
14 0.73
15 0.72
16 0.68
17 0.69
18 0.66
19 0.7
20 0.7
21 0.74
22 0.74
23 0.75
24 0.78
25 0.78
26 0.82
27 0.8
28 0.82
29 0.77
30 0.77
31 0.69
32 0.69
33 0.65
34 0.59
35 0.58
36 0.54
37 0.51
38 0.43
39 0.44
40 0.42
41 0.45
42 0.52
43 0.55
44 0.61
45 0.68
46 0.76
47 0.82
48 0.83
49 0.82
50 0.76
51 0.68
52 0.59
53 0.52
54 0.42
55 0.31
56 0.24
57 0.15
58 0.11
59 0.08
60 0.06
61 0.05
62 0.05
63 0.06
64 0.07
65 0.08
66 0.1
67 0.13
68 0.13
69 0.14
70 0.21
71 0.27
72 0.31
73 0.36
74 0.39
75 0.45
76 0.47
77 0.51
78 0.54
79 0.47
80 0.41
81 0.39
82 0.34
83 0.27
84 0.25
85 0.2
86 0.2
87 0.21
88 0.22
89 0.21
90 0.25
91 0.26
92 0.26
93 0.27
94 0.19
95 0.27
96 0.26
97 0.26
98 0.27
99 0.31
100 0.32
101 0.32
102 0.34
103 0.26
104 0.27
105 0.27
106 0.22
107 0.27
108 0.27
109 0.28
110 0.28
111 0.28
112 0.28
113 0.3
114 0.31
115 0.3
116 0.38
117 0.35
118 0.34
119 0.37
120 0.43
121 0.45
122 0.47
123 0.45
124 0.44
125 0.46
126 0.48
127 0.52
128 0.49
129 0.5
130 0.52
131 0.56
132 0.57
133 0.59
134 0.62
135 0.59
136 0.62
137 0.58
138 0.55
139 0.5
140 0.5
141 0.53
142 0.48
143 0.46
144 0.39
145 0.37
146 0.33
147 0.28
148 0.18
149 0.1
150 0.09
151 0.07
152 0.06
153 0.05
154 0.07
155 0.07
156 0.08
157 0.08
158 0.08
159 0.08
160 0.08
161 0.09
162 0.07
163 0.07
164 0.07
165 0.08
166 0.1
167 0.09
168 0.08
169 0.08
170 0.08
171 0.11