Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PCF3

Protein Details
Accession A0A4Q9PCF3    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
19-44DVCSWFATARRKQRRRERANLLVRARHydrophilic
NLS Segment(s)
PositionSequence
28-36RRKQRRRER
Subcellular Location(s) mito 16, nucl 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MLAKRVKSIPGLAHYTAQDVCSWFATARRKQRRRERANLLVRARELPPQASREESREQVKKGGAVDAKPNYIMPSDIRAVLLTQLTELMREDPNPSSEVAQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.29
4 0.24
5 0.2
6 0.16
7 0.15
8 0.13
9 0.14
10 0.12
11 0.17
12 0.25
13 0.31
14 0.41
15 0.51
16 0.57
17 0.67
18 0.77
19 0.83
20 0.84
21 0.86
22 0.85
23 0.84
24 0.85
25 0.84
26 0.76
27 0.67
28 0.58
29 0.51
30 0.42
31 0.35
32 0.27
33 0.21
34 0.21
35 0.2
36 0.2
37 0.21
38 0.21
39 0.21
40 0.23
41 0.24
42 0.28
43 0.29
44 0.3
45 0.3
46 0.29
47 0.27
48 0.25
49 0.27
50 0.22
51 0.2
52 0.25
53 0.24
54 0.24
55 0.23
56 0.22
57 0.18
58 0.17
59 0.17
60 0.11
61 0.13
62 0.14
63 0.14
64 0.14
65 0.14
66 0.13
67 0.14
68 0.14
69 0.09
70 0.08
71 0.1
72 0.1
73 0.1
74 0.11
75 0.12
76 0.12
77 0.13
78 0.16
79 0.17
80 0.19
81 0.19
82 0.19