Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PU57

Protein Details
Accession A0A4Q9PU57    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
35-61LLARRCLRGHHRHARRRDRRGRTAGPSBasic
NLS Segment(s)
PositionSequence
13-13R
42-61RGHHRHARRRDRRGRTAGPS
Subcellular Location(s) mito 14, nucl 5, extr 4, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MDAASPRRRGDSRRAWRPGASRGPWVGPCLDIALLLARRCLRGHHRHARRRDRRGRTAGPSTRGARPCWRRLTWSTLQCIRFERP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.67
3 0.68
4 0.68
5 0.67
6 0.65
7 0.56
8 0.51
9 0.46
10 0.47
11 0.42
12 0.39
13 0.3
14 0.21
15 0.18
16 0.14
17 0.12
18 0.08
19 0.07
20 0.09
21 0.1
22 0.1
23 0.11
24 0.11
25 0.12
26 0.12
27 0.15
28 0.21
29 0.28
30 0.38
31 0.46
32 0.56
33 0.63
34 0.73
35 0.81
36 0.83
37 0.85
38 0.86
39 0.85
40 0.85
41 0.85
42 0.82
43 0.78
44 0.78
45 0.73
46 0.66
47 0.63
48 0.57
49 0.56
50 0.52
51 0.49
52 0.49
53 0.51
54 0.55
55 0.57
56 0.57
57 0.56
58 0.58
59 0.62
60 0.62
61 0.6
62 0.6
63 0.59
64 0.59
65 0.55