Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9PJA0

Protein Details
Accession A0A4Q9PJA0    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
32-52CLPLVKSCRARQRRKAAQAMTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 8.333, nucl 8, mito 7, cyto 6.5, cyto_pero 5.666, pero 3.5
Family & Domain DBs
Amino Acid Sequences MNVIHGVDGMYSHERNHRFRPMWQRGSCPENCLPLVKSCRARQRRKAAQAMTIPFMPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.37
4 0.43
5 0.41
6 0.48
7 0.57
8 0.61
9 0.65
10 0.62
11 0.61
12 0.56
13 0.6
14 0.53
15 0.47
16 0.38
17 0.31
18 0.3
19 0.27
20 0.24
21 0.24
22 0.28
23 0.29
24 0.33
25 0.36
26 0.47
27 0.55
28 0.64
29 0.68
30 0.75
31 0.8
32 0.83
33 0.86
34 0.79
35 0.77
36 0.74
37 0.68
38 0.61