Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V2K765

Protein Details
Accession A0A4V2K765    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
50-73GDAISRTSRARRKRRNWQRRASALHydrophilic
NLS Segment(s)
PositionSequence
58-69RARRKRRNWQRR
Subcellular Location(s) mito 9, plas 8, extr 8
Family & Domain DBs
Amino Acid Sequences SRRRDGATYCMPLRRKSMGMAVLMAVSRLVRLVLASRRLPLTRILAFLYGDAISRTSRARRKRRNWQRRASAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.39
3 0.35
4 0.37
5 0.33
6 0.31
7 0.28
8 0.23
9 0.2
10 0.18
11 0.15
12 0.1
13 0.06
14 0.05
15 0.04
16 0.04
17 0.03
18 0.03
19 0.07
20 0.1
21 0.15
22 0.15
23 0.16
24 0.18
25 0.18
26 0.19
27 0.18
28 0.2
29 0.17
30 0.18
31 0.18
32 0.17
33 0.17
34 0.16
35 0.14
36 0.1
37 0.09
38 0.08
39 0.08
40 0.07
41 0.09
42 0.12
43 0.19
44 0.27
45 0.37
46 0.48
47 0.58
48 0.69
49 0.79
50 0.87
51 0.91
52 0.93
53 0.94