Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9NJP9

Protein Details
Accession A0A4Q9NJP9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
52-75YPVRCPCAPRNRNKPRRAMRHGNGHydrophilic
NLS Segment(s)
PositionSequence
62-77NRNKPRRAMRHGNGIR
Subcellular Location(s) mito 16, cyto 5, extr 5
Family & Domain DBs
Amino Acid Sequences MCYIHGIVACGGRLTPYVVLTTALALQSSCGSALAMRRTVAFAPASTTASVYPVRCPCAPRNRNKPRRAMRHGNGIRIPRAGDPREAILGKTESHAAVGVQVLRDAGRGAWG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.11
5 0.11
6 0.12
7 0.11
8 0.11
9 0.1
10 0.09
11 0.08
12 0.07
13 0.07
14 0.07
15 0.07
16 0.06
17 0.05
18 0.05
19 0.06
20 0.1
21 0.13
22 0.13
23 0.13
24 0.14
25 0.15
26 0.15
27 0.16
28 0.13
29 0.1
30 0.11
31 0.12
32 0.13
33 0.12
34 0.12
35 0.1
36 0.12
37 0.13
38 0.11
39 0.14
40 0.15
41 0.18
42 0.19
43 0.22
44 0.27
45 0.36
46 0.43
47 0.48
48 0.58
49 0.66
50 0.75
51 0.78
52 0.81
53 0.8
54 0.84
55 0.83
56 0.82
57 0.74
58 0.76
59 0.73
60 0.69
61 0.63
62 0.56
63 0.49
64 0.4
65 0.37
66 0.3
67 0.33
68 0.29
69 0.27
70 0.25
71 0.25
72 0.29
73 0.28
74 0.24
75 0.21
76 0.21
77 0.19
78 0.18
79 0.18
80 0.13
81 0.14
82 0.14
83 0.1
84 0.09
85 0.11
86 0.11
87 0.1
88 0.1
89 0.1
90 0.1
91 0.1
92 0.1