Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9PWU3

Protein Details
Accession A0A4Q9PWU3    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
81-123PLDLRPKKTRAIRRRLTKHEASLKTLKQRKKEIHFPIRKYAVKHydrophilic
NLS Segment(s)
PositionSequence
84-119LRPKKTRAIRRRLTKHEASLKTLKQRKKEIHFPIRK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLAKQLIELKTELGQLRVQKIAGGSAAKLTKINTVRKSIARVLTVTNQKQRQNLREFYKNKKYLPLDLRPKKTRAIRRRLTKHEASLKTLKQRKKEIHFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.52
3 0.45
4 0.5
5 0.45
6 0.42
7 0.41
8 0.44
9 0.41
10 0.38
11 0.36
12 0.28
13 0.25
14 0.26
15 0.23
16 0.17
17 0.18
18 0.19
19 0.21
20 0.21
21 0.19
22 0.17
23 0.16
24 0.15
25 0.14
26 0.12
27 0.09
28 0.12
29 0.13
30 0.12
31 0.13
32 0.12
33 0.17
34 0.22
35 0.29
36 0.29
37 0.33
38 0.36
39 0.37
40 0.41
41 0.39
42 0.36
43 0.3
44 0.27
45 0.25
46 0.28
47 0.32
48 0.31
49 0.34
50 0.36
51 0.37
52 0.42
53 0.45
54 0.46
55 0.46
56 0.5
57 0.49
58 0.54
59 0.56
60 0.59
61 0.65
62 0.62
63 0.57
64 0.58
65 0.55
66 0.54
67 0.56
68 0.57
69 0.58
70 0.62
71 0.7
72 0.66
73 0.66
74 0.65
75 0.67
76 0.68
77 0.67
78 0.69
79 0.7
80 0.76
81 0.83
82 0.85
83 0.84
84 0.8
85 0.78
86 0.78
87 0.71
88 0.67
89 0.66
90 0.62
91 0.64
92 0.66
93 0.63
94 0.61
95 0.68
96 0.71
97 0.72
98 0.77
99 0.77
100 0.81
101 0.84
102 0.81
103 0.82
104 0.81