Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V2K3V1

Protein Details
Accession A0A4V2K3V1    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
37-64KITATKREKARLRKKNKFSDRQNAQKDAHydrophilic
NLS Segment(s)
PositionSequence
20-53TAKARGRLERAKDAVAAKITATKREKARLRKKNK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MHRAKASGRVGPEHHGHASTAKARGRLERAKDAVAAKITATKREKARLRKKNKFSDRQNAQKDATASSGEPVDCNGSKSMKRVTFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.27
4 0.24
5 0.26
6 0.25
7 0.28
8 0.26
9 0.28
10 0.28
11 0.32
12 0.38
13 0.41
14 0.43
15 0.44
16 0.44
17 0.41
18 0.43
19 0.39
20 0.34
21 0.28
22 0.22
23 0.15
24 0.19
25 0.18
26 0.22
27 0.24
28 0.26
29 0.28
30 0.36
31 0.43
32 0.47
33 0.58
34 0.61
35 0.7
36 0.76
37 0.83
38 0.85
39 0.88
40 0.88
41 0.85
42 0.86
43 0.84
44 0.84
45 0.81
46 0.75
47 0.66
48 0.59
49 0.52
50 0.42
51 0.35
52 0.26
53 0.2
54 0.17
55 0.18
56 0.14
57 0.13
58 0.13
59 0.16
60 0.15
61 0.17
62 0.18
63 0.21
64 0.24
65 0.28
66 0.36