Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9MLJ6

Protein Details
Accession A0A4Q9MLJ6    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
67-87TSSRNPFRGHARKKSSPKADLHydrophilic
262-286KENARRDRLYKERPKDKPSRSVQRLBasic
NLS Segment(s)
PositionSequence
76-80HARKK
253-281RAEVKKKAAKENARRDRLYKERPKDKPSR
Subcellular Location(s) mito 14, nucl 10, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MSAPAVIRFPPPPPTRNELSSEQRAKLIRTNNKLGQVLGSTPHVLDLSYTVAPAPHTELPAPPKTPTSSRNPFRGHARKKSSPKADLEAMRKDATSPDSVASRRSTSSVRVKTDELAWRTPYSVQRPPLLKLLVPSSPSPSRSRKPNLDTIPGSPTYEPLASAPIEPPTFYIPSDAAMRREKMRRVRKMLGDGVPHDLVFPSSPEESESEDDSPLVATPTSTMSREWLLVDTNKPLPTPAELSKPLPVAPSARAEVKKKAAKENARRDRLYKERPKDKPSRSVQRLESIEENAKEAKHESLTVVGVSASLGMHGRGKSRRFIQGDVPFDQIGTAWGGHMW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.51
4 0.54
5 0.52
6 0.54
7 0.6
8 0.6
9 0.54
10 0.54
11 0.52
12 0.49
13 0.48
14 0.5
15 0.49
16 0.51
17 0.59
18 0.58
19 0.63
20 0.61
21 0.55
22 0.47
23 0.4
24 0.33
25 0.27
26 0.24
27 0.18
28 0.16
29 0.17
30 0.14
31 0.12
32 0.11
33 0.1
34 0.12
35 0.11
36 0.11
37 0.1
38 0.11
39 0.11
40 0.12
41 0.16
42 0.14
43 0.16
44 0.17
45 0.21
46 0.26
47 0.32
48 0.32
49 0.29
50 0.3
51 0.32
52 0.37
53 0.38
54 0.41
55 0.46
56 0.5
57 0.58
58 0.58
59 0.59
60 0.64
61 0.7
62 0.69
63 0.69
64 0.73
65 0.73
66 0.79
67 0.84
68 0.82
69 0.78
70 0.74
71 0.68
72 0.66
73 0.63
74 0.6
75 0.55
76 0.5
77 0.43
78 0.39
79 0.34
80 0.29
81 0.25
82 0.22
83 0.17
84 0.15
85 0.19
86 0.19
87 0.21
88 0.21
89 0.21
90 0.19
91 0.21
92 0.21
93 0.24
94 0.34
95 0.38
96 0.39
97 0.4
98 0.4
99 0.39
100 0.43
101 0.43
102 0.37
103 0.33
104 0.31
105 0.29
106 0.29
107 0.32
108 0.31
109 0.31
110 0.33
111 0.33
112 0.36
113 0.38
114 0.39
115 0.4
116 0.36
117 0.3
118 0.25
119 0.26
120 0.22
121 0.22
122 0.2
123 0.2
124 0.22
125 0.24
126 0.28
127 0.32
128 0.34
129 0.41
130 0.47
131 0.5
132 0.52
133 0.59
134 0.57
135 0.57
136 0.54
137 0.48
138 0.44
139 0.37
140 0.33
141 0.24
142 0.21
143 0.16
144 0.14
145 0.12
146 0.08
147 0.09
148 0.09
149 0.09
150 0.09
151 0.1
152 0.1
153 0.09
154 0.1
155 0.11
156 0.11
157 0.1
158 0.11
159 0.08
160 0.1
161 0.14
162 0.14
163 0.15
164 0.17
165 0.19
166 0.22
167 0.27
168 0.32
169 0.38
170 0.47
171 0.52
172 0.58
173 0.62
174 0.62
175 0.64
176 0.63
177 0.57
178 0.49
179 0.42
180 0.38
181 0.32
182 0.27
183 0.21
184 0.15
185 0.12
186 0.09
187 0.09
188 0.07
189 0.07
190 0.08
191 0.09
192 0.1
193 0.12
194 0.13
195 0.15
196 0.13
197 0.13
198 0.13
199 0.12
200 0.11
201 0.09
202 0.07
203 0.05
204 0.04
205 0.05
206 0.08
207 0.09
208 0.1
209 0.1
210 0.11
211 0.12
212 0.13
213 0.13
214 0.11
215 0.12
216 0.14
217 0.15
218 0.17
219 0.2
220 0.2
221 0.19
222 0.19
223 0.17
224 0.18
225 0.21
226 0.2
227 0.23
228 0.25
229 0.27
230 0.29
231 0.29
232 0.27
233 0.23
234 0.22
235 0.18
236 0.17
237 0.19
238 0.19
239 0.24
240 0.28
241 0.3
242 0.35
243 0.42
244 0.44
245 0.44
246 0.51
247 0.55
248 0.61
249 0.68
250 0.73
251 0.75
252 0.78
253 0.76
254 0.7
255 0.7
256 0.7
257 0.7
258 0.69
259 0.69
260 0.71
261 0.77
262 0.83
263 0.84
264 0.82
265 0.81
266 0.81
267 0.82
268 0.79
269 0.79
270 0.74
271 0.73
272 0.67
273 0.61
274 0.54
275 0.47
276 0.47
277 0.39
278 0.37
279 0.3
280 0.28
281 0.25
282 0.23
283 0.22
284 0.17
285 0.18
286 0.17
287 0.18
288 0.18
289 0.17
290 0.15
291 0.12
292 0.1
293 0.09
294 0.09
295 0.06
296 0.05
297 0.06
298 0.07
299 0.11
300 0.13
301 0.19
302 0.26
303 0.29
304 0.36
305 0.42
306 0.5
307 0.5
308 0.53
309 0.56
310 0.58
311 0.6
312 0.55
313 0.53
314 0.43
315 0.39
316 0.36
317 0.26
318 0.18
319 0.14
320 0.11