Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9QE67

Protein Details
Accession A0A4Q9QE67    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
70-89REIRGGKKAPRKTVKDRGLDBasic
NLS Segment(s)
PositionSequence
73-81RGGKKAPRK
Subcellular Location(s) mito 17, cyto 5.5, cyto_nucl 5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003124  WH2_dom  
Gene Ontology GO:0030479  C:actin cortical patch  
GO:0003779  F:actin binding  
PROSITE View protein in PROSITE  
PS51082  WH2  
Amino Acid Sequences MPSKLAFLQALIIELGLYTSMPSLPNSLRAAKAVLKSQVFLNVRDYLAVRQQGVDALREVMHPSRSALMREIRGGKKAPRKTVKDRGLDVLLVTCYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.05
4 0.04
5 0.03
6 0.04
7 0.05
8 0.06
9 0.07
10 0.1
11 0.1
12 0.15
13 0.18
14 0.2
15 0.2
16 0.2
17 0.22
18 0.22
19 0.24
20 0.23
21 0.24
22 0.23
23 0.23
24 0.22
25 0.28
26 0.25
27 0.24
28 0.23
29 0.21
30 0.2
31 0.2
32 0.2
33 0.14
34 0.16
35 0.16
36 0.12
37 0.11
38 0.11
39 0.12
40 0.12
41 0.12
42 0.09
43 0.09
44 0.09
45 0.09
46 0.11
47 0.1
48 0.11
49 0.11
50 0.11
51 0.14
52 0.15
53 0.16
54 0.19
55 0.21
56 0.22
57 0.26
58 0.33
59 0.31
60 0.34
61 0.36
62 0.4
63 0.45
64 0.51
65 0.57
66 0.6
67 0.66
68 0.72
69 0.8
70 0.8
71 0.78
72 0.74
73 0.7
74 0.63
75 0.55
76 0.46
77 0.38