Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9Q9L2

Protein Details
Accession A0A4Q9Q9L2    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
50-77VVQQSQRKIRPSRKRPFDRSHRDWCPHSHydrophilic
NLS Segment(s)
PositionSequence
61-63SRK
Subcellular Location(s) mito 10, nucl 7, cyto 5, plas 3, cyto_pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLVPAPVQSPDRSNMVYPWLLYLPLGYVCRCLFGCVRPSGRQFPIMISMVVQQSQRKIRPSRKRPFDRSHRDWCPHSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.23
4 0.2
5 0.2
6 0.17
7 0.15
8 0.14
9 0.13
10 0.09
11 0.11
12 0.12
13 0.09
14 0.12
15 0.11
16 0.14
17 0.13
18 0.14
19 0.13
20 0.15
21 0.19
22 0.21
23 0.25
24 0.26
25 0.3
26 0.32
27 0.32
28 0.31
29 0.27
30 0.24
31 0.24
32 0.22
33 0.18
34 0.14
35 0.15
36 0.13
37 0.15
38 0.15
39 0.12
40 0.17
41 0.24
42 0.27
43 0.33
44 0.41
45 0.5
46 0.6
47 0.7
48 0.75
49 0.8
50 0.87
51 0.89
52 0.9
53 0.91
54 0.9
55 0.88
56 0.87
57 0.86
58 0.82