Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PAN7

Protein Details
Accession A0A4Q9PAN7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
46-67TLPVPPYRRCPRQRRDPIRDGGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, extr 9, cyto 4, plas 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MVFSILYNLVCRCCLSLSPAVAAKLYGSNRLAGSSGLLLTLDYLATLPVPPYRRCPRQRRDPIRDGGATGPRCPFTLEAYTFSGPPYYYSVRFVTCGRSRAVSML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.22
4 0.22
5 0.24
6 0.26
7 0.25
8 0.23
9 0.22
10 0.18
11 0.17
12 0.17
13 0.18
14 0.16
15 0.18
16 0.18
17 0.18
18 0.18
19 0.13
20 0.13
21 0.09
22 0.08
23 0.06
24 0.06
25 0.05
26 0.05
27 0.05
28 0.04
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.07
36 0.11
37 0.12
38 0.2
39 0.27
40 0.36
41 0.45
42 0.55
43 0.61
44 0.69
45 0.79
46 0.82
47 0.84
48 0.82
49 0.78
50 0.73
51 0.64
52 0.55
53 0.47
54 0.44
55 0.35
56 0.3
57 0.27
58 0.23
59 0.22
60 0.22
61 0.19
62 0.16
63 0.22
64 0.22
65 0.23
66 0.27
67 0.27
68 0.26
69 0.25
70 0.22
71 0.16
72 0.16
73 0.18
74 0.18
75 0.19
76 0.23
77 0.25
78 0.25
79 0.27
80 0.26
81 0.3
82 0.32
83 0.34
84 0.32
85 0.33