Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q9MBB6

Protein Details
Accession A0A4Q9MBB6    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
56-75SDDHKPKPSKVWRREAPTPSHydrophilic
NLS Segment(s)
PositionSequence
47-53EAKKKRD
58-90DHKPKPSKVWRREAPTPSKIYERRAPAPVPSKR
Subcellular Location(s) extr 14, plas 5, mito 2, pero 2, golg 2
Family & Domain DBs
Amino Acid Sequences MHSRLFILFAALMALLVFVAANPLPKDNVVVAKRALKQYDIKRAIAEAKKKRDDDSDDHKPKPSKVWRREAPTPSKIYERRAPAPVPSKRSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.03
3 0.03
4 0.03
5 0.02
6 0.04
7 0.04
8 0.07
9 0.07
10 0.09
11 0.09
12 0.1
13 0.11
14 0.11
15 0.19
16 0.18
17 0.19
18 0.2
19 0.26
20 0.29
21 0.31
22 0.3
23 0.25
24 0.32
25 0.36
26 0.45
27 0.42
28 0.39
29 0.36
30 0.36
31 0.4
32 0.37
33 0.4
34 0.37
35 0.42
36 0.47
37 0.48
38 0.49
39 0.47
40 0.48
41 0.46
42 0.47
43 0.5
44 0.51
45 0.51
46 0.55
47 0.53
48 0.49
49 0.52
50 0.53
51 0.53
52 0.56
53 0.65
54 0.67
55 0.73
56 0.8
57 0.79
58 0.77
59 0.74
60 0.69
61 0.61
62 0.63
63 0.59
64 0.57
65 0.56
66 0.54
67 0.53
68 0.54
69 0.53
70 0.52
71 0.58
72 0.59