Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PCH1

Protein Details
Accession A0A4Q9PCH1    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
18-37YRTTNRQSQRQRPPSHPQQEHydrophilic
55-85QTPKVEKQEKKKVPKGRAKKRMLYNRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
48-76RAGKVKSQTPKVEKQEKKKVPKGRAKKRM
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MTLELKFRRSFNIRLELYRTTNRQSQRQRPPSHPQQENMGKVHGSLARAGKVKSQTPKVEKQEKKKVPKGRAKKRMLYNRRFVNVTTLPGGKRRMNANPEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.52
3 0.49
4 0.49
5 0.49
6 0.45
7 0.4
8 0.44
9 0.45
10 0.5
11 0.55
12 0.6
13 0.65
14 0.72
15 0.73
16 0.74
17 0.79
18 0.8
19 0.8
20 0.73
21 0.64
22 0.63
23 0.64
24 0.6
25 0.52
26 0.42
27 0.32
28 0.28
29 0.29
30 0.21
31 0.15
32 0.14
33 0.14
34 0.16
35 0.17
36 0.18
37 0.18
38 0.19
39 0.23
40 0.26
41 0.31
42 0.34
43 0.38
44 0.47
45 0.52
46 0.59
47 0.62
48 0.66
49 0.71
50 0.74
51 0.78
52 0.78
53 0.78
54 0.78
55 0.82
56 0.84
57 0.84
58 0.85
59 0.84
60 0.84
61 0.85
62 0.86
63 0.86
64 0.84
65 0.82
66 0.8
67 0.76
68 0.69
69 0.59
70 0.57
71 0.49
72 0.43
73 0.38
74 0.33
75 0.3
76 0.34
77 0.39
78 0.34
79 0.36
80 0.39
81 0.44