Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9PS63

Protein Details
Accession A0A4Q9PS63    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-27RPKLSRAAAKWKTQRPRPQVPFPSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MQSRPKLSRAAAKWKTQRPRPQVPFPSVLASCAMSEVLEELVCLWPRTLVAMDWRLTNYEGSGQEATAGTAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.77
3 0.77
4 0.8
5 0.78
6 0.82
7 0.8
8 0.82
9 0.79
10 0.75
11 0.69
12 0.6
13 0.56
14 0.44
15 0.37
16 0.27
17 0.21
18 0.16
19 0.12
20 0.1
21 0.06
22 0.06
23 0.05
24 0.04
25 0.04
26 0.03
27 0.04
28 0.06
29 0.07
30 0.07
31 0.07
32 0.07
33 0.07
34 0.09
35 0.09
36 0.07
37 0.12
38 0.16
39 0.17
40 0.18
41 0.19
42 0.19
43 0.19
44 0.19
45 0.15
46 0.16
47 0.16
48 0.19
49 0.19
50 0.17
51 0.17
52 0.17