Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q9NNB8

Protein Details
Accession A0A4Q9NNB8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
64-86EHMRRNPNYVYKPNKKTRSDHRRBasic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences PNWAPRPPNAFILFRRTYAEKHKGEEVQLPEKLTLSKRASAAWRSLTPQEKRPWYDAAKEGAAEHMRRNPNYVYKPNKKTRSDHRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.35
4 0.35
5 0.39
6 0.46
7 0.4
8 0.41
9 0.45
10 0.43
11 0.43
12 0.45
13 0.41
14 0.37
15 0.36
16 0.34
17 0.29
18 0.27
19 0.27
20 0.22
21 0.25
22 0.22
23 0.23
24 0.23
25 0.25
26 0.28
27 0.28
28 0.29
29 0.24
30 0.23
31 0.22
32 0.26
33 0.31
34 0.3
35 0.35
36 0.39
37 0.41
38 0.43
39 0.44
40 0.45
41 0.4
42 0.42
43 0.39
44 0.36
45 0.31
46 0.29
47 0.26
48 0.25
49 0.26
50 0.22
51 0.21
52 0.25
53 0.31
54 0.31
55 0.34
56 0.34
57 0.4
58 0.47
59 0.54
60 0.57
61 0.61
62 0.71
63 0.78
64 0.83
65 0.81
66 0.81