Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4TRE4

Protein Details
Accession A0A4Q4TRE4   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
96-124TPLLRSSRPKGVRKGIRSKKEKWRWVFTPHydrophilic
NLS Segment(s)
PositionSequence
102-118SRPKGVRKGIRSKKEKW
Subcellular Location(s) mito 20, nucl 4.5, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MPSQAASTKAQVAPAVASTSFRPGRRPSSRSSKEIAHQRVHGGSIAVHSVANRRRLRDGAGSRRGYPYDGTRNGRQTLRPFEEMRRCVTELGITETPLLRSSRPKGVRKGIRSKKEKWRWVFTPNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.13
4 0.14
5 0.13
6 0.2
7 0.24
8 0.24
9 0.28
10 0.31
11 0.41
12 0.49
13 0.51
14 0.51
15 0.58
16 0.63
17 0.62
18 0.6
19 0.55
20 0.53
21 0.59
22 0.58
23 0.51
24 0.46
25 0.44
26 0.41
27 0.37
28 0.31
29 0.21
30 0.15
31 0.12
32 0.11
33 0.08
34 0.07
35 0.07
36 0.12
37 0.16
38 0.25
39 0.26
40 0.27
41 0.3
42 0.31
43 0.33
44 0.36
45 0.4
46 0.41
47 0.47
48 0.47
49 0.46
50 0.46
51 0.44
52 0.36
53 0.29
54 0.25
55 0.24
56 0.29
57 0.32
58 0.34
59 0.38
60 0.4
61 0.4
62 0.39
63 0.36
64 0.39
65 0.39
66 0.39
67 0.38
68 0.42
69 0.49
70 0.47
71 0.46
72 0.42
73 0.38
74 0.35
75 0.33
76 0.28
77 0.2
78 0.25
79 0.22
80 0.18
81 0.18
82 0.18
83 0.18
84 0.18
85 0.18
86 0.13
87 0.19
88 0.23
89 0.33
90 0.41
91 0.47
92 0.54
93 0.63
94 0.71
95 0.73
96 0.8
97 0.81
98 0.82
99 0.82
100 0.83
101 0.84
102 0.85
103 0.86
104 0.83
105 0.82
106 0.77