Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4UDP0

Protein Details
Accession A0A4Q4UDP0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
69-90NLIVRAGKRKPKPKESAGQDHLHydrophilic
NLS Segment(s)
PositionSequence
75-82GKRKPKPK
Subcellular Location(s) extr 13, plas 7, mito 2, E.R. 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MASRCSTTHASSLLFFFVLLISIAASPVAAQDEPRVNIARDITIVVSVSISVTVVITVLVCVCAHCGPNLIVRAGKRKPKPKESAGQDHLEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.14
3 0.11
4 0.08
5 0.07
6 0.06
7 0.05
8 0.05
9 0.05
10 0.05
11 0.04
12 0.04
13 0.03
14 0.04
15 0.05
16 0.05
17 0.05
18 0.08
19 0.12
20 0.13
21 0.15
22 0.16
23 0.15
24 0.16
25 0.17
26 0.14
27 0.11
28 0.11
29 0.09
30 0.08
31 0.07
32 0.06
33 0.05
34 0.04
35 0.04
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.05
50 0.06
51 0.07
52 0.07
53 0.1
54 0.1
55 0.15
56 0.17
57 0.17
58 0.18
59 0.21
60 0.29
61 0.34
62 0.42
63 0.47
64 0.55
65 0.64
66 0.71
67 0.78
68 0.78
69 0.81
70 0.81
71 0.83
72 0.79