Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4UPR0

Protein Details
Accession A0A4Q4UPR0   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
340-366SDELRTKFGAPKRKRRRKPEILVIYGLHydrophilic
NLS Segment(s)
PositionSequence
346-358KFGAPKRKRRRKP
Subcellular Location(s) nucl 13.5, cyto_nucl 12, cyto 9.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MPITIYQGYTTRLTPSAMGLLELATPRDSADLSSAHTDAQTSGNKLSDIAWLCHLFPCRRYGARVLSYEYDIATLTAPGGSAATDICGEAVKLVNELQGDRYIQDVESRPIVFVCHRFGGLLVKRALSFSHSRRGARVEHLRSIFRSAVGVLFMSTPHNGITKQSPAVGEFNQYGGPSQFLLSLLEGSEALQEITDQFAPLMKTFFIYNSWEQIATNFGKSSMVKYTSESSPGFLIVLATLDRYIRAADSPIRKRWQKDAELLRKERLAEFEDLIQSQHPAGSVRSLGVSGSDSATLLDSSAISEAEADDFLDGETSPSVNVHYLVHRRSEYFVGRLRQSDELRTKFGAPKRKRRRKPEILVIYGLFGSGETKFCLRSSEDNRHRYWGVFWIDCSSEANPNASFALLGERA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.21
4 0.19
5 0.18
6 0.15
7 0.14
8 0.15
9 0.15
10 0.14
11 0.11
12 0.11
13 0.11
14 0.12
15 0.11
16 0.1
17 0.12
18 0.12
19 0.14
20 0.17
21 0.17
22 0.16
23 0.16
24 0.16
25 0.14
26 0.19
27 0.2
28 0.2
29 0.22
30 0.23
31 0.23
32 0.23
33 0.22
34 0.23
35 0.22
36 0.21
37 0.24
38 0.24
39 0.25
40 0.28
41 0.33
42 0.3
43 0.29
44 0.32
45 0.34
46 0.35
47 0.38
48 0.41
49 0.44
50 0.47
51 0.48
52 0.47
53 0.43
54 0.43
55 0.39
56 0.32
57 0.24
58 0.18
59 0.15
60 0.11
61 0.08
62 0.07
63 0.06
64 0.06
65 0.05
66 0.05
67 0.05
68 0.05
69 0.04
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.06
77 0.08
78 0.07
79 0.08
80 0.08
81 0.1
82 0.1
83 0.11
84 0.12
85 0.13
86 0.13
87 0.13
88 0.13
89 0.13
90 0.12
91 0.16
92 0.17
93 0.17
94 0.2
95 0.2
96 0.18
97 0.18
98 0.19
99 0.18
100 0.18
101 0.2
102 0.17
103 0.17
104 0.17
105 0.17
106 0.24
107 0.24
108 0.27
109 0.25
110 0.24
111 0.25
112 0.25
113 0.25
114 0.2
115 0.24
116 0.22
117 0.3
118 0.33
119 0.34
120 0.36
121 0.39
122 0.38
123 0.39
124 0.45
125 0.41
126 0.43
127 0.45
128 0.45
129 0.42
130 0.43
131 0.35
132 0.26
133 0.22
134 0.15
135 0.13
136 0.12
137 0.11
138 0.07
139 0.06
140 0.07
141 0.07
142 0.07
143 0.07
144 0.07
145 0.08
146 0.08
147 0.1
148 0.13
149 0.14
150 0.15
151 0.16
152 0.16
153 0.16
154 0.19
155 0.17
156 0.16
157 0.14
158 0.14
159 0.13
160 0.12
161 0.11
162 0.09
163 0.09
164 0.07
165 0.07
166 0.07
167 0.07
168 0.07
169 0.07
170 0.07
171 0.06
172 0.06
173 0.05
174 0.05
175 0.05
176 0.04
177 0.04
178 0.04
179 0.04
180 0.03
181 0.05
182 0.05
183 0.04
184 0.04
185 0.06
186 0.07
187 0.07
188 0.08
189 0.07
190 0.07
191 0.07
192 0.08
193 0.08
194 0.11
195 0.11
196 0.12
197 0.13
198 0.13
199 0.12
200 0.12
201 0.14
202 0.12
203 0.12
204 0.1
205 0.09
206 0.11
207 0.11
208 0.13
209 0.13
210 0.15
211 0.15
212 0.16
213 0.2
214 0.19
215 0.23
216 0.21
217 0.18
218 0.16
219 0.15
220 0.13
221 0.1
222 0.09
223 0.05
224 0.05
225 0.04
226 0.04
227 0.04
228 0.04
229 0.05
230 0.05
231 0.05
232 0.05
233 0.05
234 0.07
235 0.13
236 0.22
237 0.28
238 0.34
239 0.41
240 0.44
241 0.47
242 0.54
243 0.57
244 0.53
245 0.56
246 0.6
247 0.63
248 0.68
249 0.68
250 0.61
251 0.54
252 0.51
253 0.43
254 0.35
255 0.29
256 0.22
257 0.2
258 0.2
259 0.2
260 0.19
261 0.18
262 0.15
263 0.12
264 0.1
265 0.1
266 0.08
267 0.08
268 0.08
269 0.09
270 0.09
271 0.09
272 0.09
273 0.09
274 0.08
275 0.08
276 0.09
277 0.08
278 0.08
279 0.07
280 0.07
281 0.07
282 0.08
283 0.07
284 0.06
285 0.06
286 0.05
287 0.05
288 0.06
289 0.06
290 0.05
291 0.05
292 0.05
293 0.06
294 0.06
295 0.05
296 0.05
297 0.05
298 0.05
299 0.05
300 0.05
301 0.05
302 0.05
303 0.05
304 0.06
305 0.06
306 0.07
307 0.07
308 0.08
309 0.09
310 0.15
311 0.21
312 0.23
313 0.28
314 0.29
315 0.3
316 0.32
317 0.36
318 0.33
319 0.32
320 0.37
321 0.38
322 0.39
323 0.4
324 0.4
325 0.42
326 0.4
327 0.44
328 0.46
329 0.44
330 0.46
331 0.45
332 0.46
333 0.46
334 0.5
335 0.52
336 0.53
337 0.6
338 0.68
339 0.78
340 0.84
341 0.87
342 0.92
343 0.93
344 0.93
345 0.93
346 0.92
347 0.86
348 0.8
349 0.69
350 0.59
351 0.48
352 0.37
353 0.26
354 0.15
355 0.11
356 0.09
357 0.09
358 0.1
359 0.11
360 0.13
361 0.13
362 0.17
363 0.19
364 0.28
365 0.36
366 0.45
367 0.54
368 0.59
369 0.61
370 0.64
371 0.62
372 0.53
373 0.47
374 0.44
375 0.41
376 0.36
377 0.35
378 0.33
379 0.33
380 0.32
381 0.32
382 0.26
383 0.26
384 0.25
385 0.27
386 0.23
387 0.24
388 0.23
389 0.2
390 0.18
391 0.12