Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1XA80

Protein Details
Accession A0A4V1XA80   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
25-51LTSVAKERKAHRKKKCRSDAEEKLRLVHydrophilic
NLS Segment(s)
PositionSequence
31-39ERKAHRKKK
Subcellular Location(s) mito 11, cyto 10, nucl 5
Family & Domain DBs
Amino Acid Sequences MVIQLPSFPELSNAWRLTRIDYFDLTSVAKERKAHRKKKCRSDAEEKLRLVTRPSLEQLVLMKIVELPGAAMPHGEGDAGVLGPRRQEHRAAVPRARDGGGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.27
4 0.29
5 0.31
6 0.31
7 0.27
8 0.26
9 0.27
10 0.24
11 0.24
12 0.2
13 0.17
14 0.17
15 0.16
16 0.17
17 0.2
18 0.26
19 0.36
20 0.46
21 0.55
22 0.63
23 0.72
24 0.79
25 0.86
26 0.89
27 0.87
28 0.85
29 0.85
30 0.85
31 0.84
32 0.81
33 0.7
34 0.61
35 0.54
36 0.46
37 0.37
38 0.3
39 0.22
40 0.17
41 0.18
42 0.17
43 0.15
44 0.16
45 0.15
46 0.13
47 0.12
48 0.1
49 0.08
50 0.07
51 0.07
52 0.06
53 0.05
54 0.04
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.03
64 0.04
65 0.04
66 0.04
67 0.05
68 0.06
69 0.07
70 0.09
71 0.12
72 0.16
73 0.19
74 0.23
75 0.27
76 0.37
77 0.46
78 0.52
79 0.55
80 0.56
81 0.58
82 0.57