Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1XD72

Protein Details
Accession A0A4V1XD72   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-31QVETGHKTPRKPDRTRPLKTYSKKATHydrophilic
NLS Segment(s)
PositionSequence
130-133KKRR
200-203RGRG
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028005  AcTrfase_ESCO_Znf_dom  
Pfam View protein in Pfam  
PF13878  zf-C2H2_3  
Amino Acid Sequences MSSGSQVETGHKTPRKPDRTRPLKTYSKKATSSGSTELPAKRRHTGEVAETTRTKERESPSLQQDNRSQPSLPPPHASRDPKRGTIMSYFKVVSPSSNHMSSYSEPSSCGVEPASTPPSSPPLKTDSGPKKRRRLTTKVVSKDLDVTGDAEEETVGRPDPETDQPTTTQRENSGILADTSKDALNKAAAQQEQRLEAGKRGRGKGPNSKPVVVQTTLSLSMSDKGFVECKACNMLYNPYHEKDAKFHARRHAAMLKSKPQRGSEIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.62
3 0.65
4 0.73
5 0.75
6 0.81
7 0.85
8 0.83
9 0.82
10 0.82
11 0.81
12 0.81
13 0.8
14 0.77
15 0.72
16 0.68
17 0.65
18 0.59
19 0.57
20 0.5
21 0.42
22 0.36
23 0.39
24 0.4
25 0.4
26 0.42
27 0.41
28 0.44
29 0.43
30 0.45
31 0.44
32 0.43
33 0.43
34 0.46
35 0.45
36 0.43
37 0.42
38 0.42
39 0.43
40 0.4
41 0.36
42 0.32
43 0.33
44 0.38
45 0.43
46 0.47
47 0.5
48 0.59
49 0.57
50 0.57
51 0.6
52 0.6
53 0.57
54 0.52
55 0.44
56 0.36
57 0.44
58 0.46
59 0.41
60 0.38
61 0.37
62 0.41
63 0.49
64 0.55
65 0.52
66 0.55
67 0.57
68 0.55
69 0.56
70 0.51
71 0.45
72 0.45
73 0.44
74 0.35
75 0.33
76 0.3
77 0.27
78 0.28
79 0.25
80 0.19
81 0.18
82 0.21
83 0.22
84 0.22
85 0.22
86 0.2
87 0.23
88 0.23
89 0.25
90 0.22
91 0.18
92 0.18
93 0.18
94 0.2
95 0.17
96 0.16
97 0.1
98 0.09
99 0.09
100 0.12
101 0.14
102 0.11
103 0.12
104 0.12
105 0.17
106 0.18
107 0.18
108 0.16
109 0.18
110 0.2
111 0.21
112 0.3
113 0.35
114 0.44
115 0.53
116 0.59
117 0.64
118 0.69
119 0.77
120 0.75
121 0.72
122 0.71
123 0.72
124 0.74
125 0.7
126 0.67
127 0.59
128 0.52
129 0.46
130 0.37
131 0.27
132 0.18
133 0.13
134 0.1
135 0.09
136 0.08
137 0.06
138 0.05
139 0.05
140 0.05
141 0.05
142 0.04
143 0.04
144 0.05
145 0.06
146 0.09
147 0.13
148 0.16
149 0.17
150 0.19
151 0.21
152 0.24
153 0.27
154 0.25
155 0.23
156 0.21
157 0.22
158 0.21
159 0.2
160 0.18
161 0.15
162 0.14
163 0.13
164 0.12
165 0.1
166 0.1
167 0.1
168 0.09
169 0.09
170 0.09
171 0.1
172 0.11
173 0.13
174 0.17
175 0.18
176 0.2
177 0.23
178 0.24
179 0.24
180 0.23
181 0.24
182 0.2
183 0.23
184 0.27
185 0.29
186 0.34
187 0.35
188 0.41
189 0.45
190 0.51
191 0.56
192 0.6
193 0.64
194 0.63
195 0.61
196 0.56
197 0.55
198 0.53
199 0.43
200 0.34
201 0.26
202 0.25
203 0.24
204 0.23
205 0.18
206 0.14
207 0.16
208 0.15
209 0.15
210 0.12
211 0.13
212 0.14
213 0.15
214 0.17
215 0.14
216 0.16
217 0.2
218 0.2
219 0.2
220 0.21
221 0.29
222 0.29
223 0.36
224 0.39
225 0.36
226 0.42
227 0.43
228 0.42
229 0.38
230 0.45
231 0.49
232 0.49
233 0.53
234 0.57
235 0.63
236 0.62
237 0.66
238 0.64
239 0.59
240 0.62
241 0.65
242 0.64
243 0.66
244 0.7
245 0.68
246 0.63