Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4UT70

Protein Details
Accession A0A4Q4UT70   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
30-53GEQIHRRTERRRHRVPTNKKNGPSBasic
NLS Segment(s)
PositionSequence
39-44RRRHRV
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 6
Family & Domain DBs
Amino Acid Sequences MGVSIPNTFDMRSRSAVLPEPADKYRQTLGEQIHRRTERRRHRVPTNKKNGPSLLGNEGRAAQGAPPPPFYYASAWRVFGFQRNATLEFPLHRSPSKERRREQLVLML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.32
4 0.32
5 0.32
6 0.31
7 0.32
8 0.3
9 0.31
10 0.29
11 0.27
12 0.27
13 0.25
14 0.25
15 0.25
16 0.29
17 0.36
18 0.42
19 0.42
20 0.47
21 0.48
22 0.49
23 0.52
24 0.58
25 0.59
26 0.62
27 0.69
28 0.67
29 0.75
30 0.82
31 0.85
32 0.86
33 0.86
34 0.83
35 0.76
36 0.72
37 0.62
38 0.54
39 0.45
40 0.36
41 0.31
42 0.26
43 0.24
44 0.21
45 0.2
46 0.17
47 0.15
48 0.13
49 0.07
50 0.09
51 0.13
52 0.13
53 0.14
54 0.15
55 0.17
56 0.18
57 0.19
58 0.2
59 0.22
60 0.25
61 0.25
62 0.26
63 0.25
64 0.25
65 0.24
66 0.27
67 0.26
68 0.22
69 0.26
70 0.28
71 0.3
72 0.29
73 0.3
74 0.25
75 0.23
76 0.27
77 0.26
78 0.26
79 0.26
80 0.3
81 0.37
82 0.47
83 0.55
84 0.6
85 0.62
86 0.68
87 0.74
88 0.73