Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4U2T2

Protein Details
Accession A0A4Q4U2T2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-34GSKLRLGSRKHQNPRHSARWNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MRGPAPSYRPLVAGSKLRLGSRKHQNPRHSARWNSSTSGTAEGSRRPLPPNHAGDTKAKILAGRKPWIPLVHRYWQTGLEVPLEDSELGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.34
4 0.35
5 0.39
6 0.39
7 0.44
8 0.49
9 0.56
10 0.61
11 0.67
12 0.72
13 0.76
14 0.8
15 0.81
16 0.78
17 0.72
18 0.68
19 0.66
20 0.61
21 0.53
22 0.46
23 0.38
24 0.31
25 0.29
26 0.23
27 0.18
28 0.17
29 0.16
30 0.18
31 0.19
32 0.19
33 0.18
34 0.2
35 0.23
36 0.29
37 0.32
38 0.33
39 0.33
40 0.33
41 0.34
42 0.36
43 0.32
44 0.25
45 0.21
46 0.19
47 0.2
48 0.25
49 0.28
50 0.28
51 0.28
52 0.3
53 0.33
54 0.36
55 0.37
56 0.38
57 0.39
58 0.44
59 0.45
60 0.46
61 0.44
62 0.41
63 0.4
64 0.36
65 0.31
66 0.24
67 0.21
68 0.2
69 0.19
70 0.18