Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4T6S5

Protein Details
Accession A0A4Q4T6S5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
46-65AGSSRNYRRLPKSPRTRITIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR004147  ABC1_dom  
IPR011009  Kinase-like_dom_sf  
Pfam View protein in Pfam  
PF03109  ABC1  
Amino Acid Sequences MKALSSNFLNRLASNGRWTCSNCRNHILASHVKTIQRQPPTKQYTAGSSRNYRRLPKSPRTRITILTAAATGAAGAGALAFTDDIKYGYRTSLNQRDKIEDEEERDRILRSCHRRCAERTLRVLERNGGIFIKLGQHLSAMTYLLPYEWTSTFVPLQDRCPVSSYASIAQMFRDDTGEDLKDYFSEFAEEPIGAASLAQVHLATVKETGQRVAVKVQHPGLALWAPLDLALTKFTFSTLKKFFPEYDLEWLSSEMEVSLPQELDFQQEAANAMRTQKHFAQMPELPLVIPNVIWAKKRILVMANERRAGGRAATTSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.32
4 0.36
5 0.4
6 0.44
7 0.48
8 0.54
9 0.5
10 0.53
11 0.54
12 0.51
13 0.5
14 0.48
15 0.48
16 0.45
17 0.46
18 0.44
19 0.44
20 0.47
21 0.51
22 0.52
23 0.53
24 0.54
25 0.54
26 0.61
27 0.67
28 0.65
29 0.61
30 0.55
31 0.54
32 0.56
33 0.56
34 0.52
35 0.54
36 0.59
37 0.64
38 0.67
39 0.66
40 0.66
41 0.69
42 0.72
43 0.73
44 0.77
45 0.79
46 0.8
47 0.8
48 0.76
49 0.69
50 0.66
51 0.59
52 0.49
53 0.39
54 0.32
55 0.25
56 0.21
57 0.17
58 0.1
59 0.05
60 0.04
61 0.03
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.03
69 0.03
70 0.04
71 0.05
72 0.06
73 0.08
74 0.09
75 0.11
76 0.13
77 0.15
78 0.24
79 0.34
80 0.39
81 0.43
82 0.44
83 0.47
84 0.47
85 0.47
86 0.43
87 0.35
88 0.34
89 0.33
90 0.32
91 0.28
92 0.27
93 0.24
94 0.21
95 0.23
96 0.27
97 0.32
98 0.39
99 0.46
100 0.49
101 0.54
102 0.56
103 0.63
104 0.63
105 0.61
106 0.59
107 0.57
108 0.57
109 0.55
110 0.53
111 0.44
112 0.36
113 0.29
114 0.25
115 0.18
116 0.14
117 0.11
118 0.1
119 0.11
120 0.1
121 0.09
122 0.08
123 0.08
124 0.08
125 0.09
126 0.08
127 0.06
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.06
135 0.06
136 0.1
137 0.1
138 0.11
139 0.12
140 0.12
141 0.15
142 0.14
143 0.16
144 0.18
145 0.19
146 0.18
147 0.2
148 0.19
149 0.18
150 0.18
151 0.18
152 0.14
153 0.16
154 0.16
155 0.14
156 0.13
157 0.12
158 0.11
159 0.1
160 0.09
161 0.06
162 0.07
163 0.09
164 0.09
165 0.08
166 0.09
167 0.08
168 0.08
169 0.08
170 0.08
171 0.06
172 0.08
173 0.08
174 0.08
175 0.09
176 0.08
177 0.08
178 0.07
179 0.07
180 0.05
181 0.05
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.06
189 0.06
190 0.06
191 0.06
192 0.08
193 0.11
194 0.12
195 0.12
196 0.14
197 0.15
198 0.16
199 0.2
200 0.24
201 0.22
202 0.26
203 0.27
204 0.25
205 0.25
206 0.24
207 0.21
208 0.17
209 0.15
210 0.11
211 0.1
212 0.07
213 0.07
214 0.07
215 0.05
216 0.05
217 0.07
218 0.07
219 0.07
220 0.07
221 0.08
222 0.13
223 0.13
224 0.21
225 0.24
226 0.27
227 0.29
228 0.32
229 0.32
230 0.31
231 0.35
232 0.3
233 0.33
234 0.31
235 0.3
236 0.28
237 0.27
238 0.24
239 0.19
240 0.16
241 0.09
242 0.07
243 0.07
244 0.07
245 0.08
246 0.07
247 0.07
248 0.09
249 0.09
250 0.14
251 0.14
252 0.13
253 0.12
254 0.13
255 0.14
256 0.14
257 0.17
258 0.13
259 0.16
260 0.22
261 0.23
262 0.28
263 0.3
264 0.34
265 0.35
266 0.36
267 0.41
268 0.39
269 0.41
270 0.38
271 0.35
272 0.29
273 0.26
274 0.25
275 0.18
276 0.14
277 0.13
278 0.16
279 0.19
280 0.21
281 0.23
282 0.26
283 0.3
284 0.32
285 0.33
286 0.32
287 0.37
288 0.46
289 0.54
290 0.57
291 0.54
292 0.53
293 0.5
294 0.46
295 0.4
296 0.32
297 0.25