Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4UC90

Protein Details
Accession A0A4Q4UC90    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
256-285VKAACHEWRERVRRERQRRDKLHTAWRKEGBasic
NLS Segment(s)
PositionSequence
93-110LKKGRSRDPGGDAGKKRG
267-276VRRERQRRDK
Subcellular Location(s) mito 19, nucl 5, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002661  Ribosome_recyc_fac  
IPR023584  Ribosome_recyc_fac_dom  
IPR036191  RRF_sf  
Gene Ontology GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01765  RRF  
Amino Acid Sequences MRTISSSFLSRIPARPELALIYQNVRGSNMTRAVAAASASTSSAQYSATCRRCHDQPAPSPLLAPPAPRTIASSRRGRNPSAPASFHTTSPGLKKGRSRDPGGDAGKKRGAGAAAAEAQDAGDAGAKHPTPTPEDPLDFADVRSRIARHDEHYADALKKLRSGGRFNPDVLGALRVAVSKGSPAETYPLRELAQVIPRGGRTVSILAHEAGSIRAIMSAVQASPEFNQQPQRDPDNELELVMKIEAESRDDVVRRVKAACHEWRERVRRERQRRDKLHTAWRKEGNLGPDLKRTADKQLDKIIKAKMTEIDAAEKEALKAAEGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.36
4 0.34
5 0.33
6 0.3
7 0.26
8 0.25
9 0.26
10 0.27
11 0.26
12 0.24
13 0.22
14 0.21
15 0.25
16 0.26
17 0.24
18 0.22
19 0.21
20 0.21
21 0.2
22 0.18
23 0.12
24 0.08
25 0.08
26 0.08
27 0.09
28 0.08
29 0.08
30 0.08
31 0.08
32 0.09
33 0.14
34 0.23
35 0.29
36 0.31
37 0.35
38 0.39
39 0.43
40 0.5
41 0.53
42 0.53
43 0.55
44 0.61
45 0.62
46 0.57
47 0.54
48 0.46
49 0.44
50 0.35
51 0.29
52 0.23
53 0.23
54 0.24
55 0.23
56 0.27
57 0.27
58 0.34
59 0.38
60 0.44
61 0.45
62 0.53
63 0.57
64 0.56
65 0.57
66 0.56
67 0.58
68 0.54
69 0.51
70 0.44
71 0.49
72 0.46
73 0.4
74 0.36
75 0.29
76 0.26
77 0.27
78 0.32
79 0.26
80 0.28
81 0.34
82 0.38
83 0.47
84 0.5
85 0.52
86 0.49
87 0.52
88 0.57
89 0.56
90 0.57
91 0.49
92 0.48
93 0.46
94 0.41
95 0.36
96 0.29
97 0.24
98 0.16
99 0.15
100 0.13
101 0.12
102 0.12
103 0.11
104 0.1
105 0.09
106 0.08
107 0.07
108 0.05
109 0.05
110 0.05
111 0.05
112 0.09
113 0.09
114 0.1
115 0.12
116 0.13
117 0.16
118 0.18
119 0.23
120 0.22
121 0.23
122 0.23
123 0.23
124 0.25
125 0.19
126 0.18
127 0.17
128 0.15
129 0.15
130 0.16
131 0.14
132 0.13
133 0.17
134 0.19
135 0.17
136 0.23
137 0.23
138 0.22
139 0.24
140 0.25
141 0.21
142 0.21
143 0.22
144 0.16
145 0.16
146 0.17
147 0.18
148 0.2
149 0.24
150 0.28
151 0.3
152 0.32
153 0.31
154 0.3
155 0.27
156 0.24
157 0.2
158 0.15
159 0.09
160 0.07
161 0.07
162 0.07
163 0.06
164 0.05
165 0.05
166 0.05
167 0.05
168 0.06
169 0.06
170 0.06
171 0.1
172 0.1
173 0.13
174 0.14
175 0.15
176 0.15
177 0.15
178 0.16
179 0.16
180 0.2
181 0.19
182 0.19
183 0.18
184 0.18
185 0.18
186 0.17
187 0.14
188 0.1
189 0.1
190 0.11
191 0.11
192 0.12
193 0.11
194 0.11
195 0.11
196 0.09
197 0.08
198 0.07
199 0.06
200 0.05
201 0.05
202 0.05
203 0.05
204 0.05
205 0.06
206 0.05
207 0.06
208 0.06
209 0.07
210 0.08
211 0.13
212 0.13
213 0.14
214 0.23
215 0.23
216 0.3
217 0.34
218 0.38
219 0.35
220 0.38
221 0.38
222 0.36
223 0.35
224 0.29
225 0.25
226 0.2
227 0.18
228 0.15
229 0.12
230 0.06
231 0.09
232 0.09
233 0.11
234 0.11
235 0.12
236 0.16
237 0.16
238 0.19
239 0.22
240 0.24
241 0.23
242 0.24
243 0.25
244 0.28
245 0.35
246 0.41
247 0.43
248 0.47
249 0.54
250 0.62
251 0.68
252 0.7
253 0.72
254 0.75
255 0.78
256 0.83
257 0.87
258 0.88
259 0.91
260 0.91
261 0.9
262 0.9
263 0.87
264 0.87
265 0.85
266 0.82
267 0.79
268 0.77
269 0.71
270 0.64
271 0.61
272 0.54
273 0.5
274 0.47
275 0.42
276 0.41
277 0.4
278 0.38
279 0.37
280 0.35
281 0.38
282 0.42
283 0.45
284 0.44
285 0.53
286 0.57
287 0.56
288 0.59
289 0.56
290 0.51
291 0.47
292 0.44
293 0.38
294 0.35
295 0.36
296 0.33
297 0.33
298 0.3
299 0.31
300 0.3
301 0.27
302 0.23
303 0.23
304 0.21